Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q752B3

Protein Details
Accession Q752B3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
313-343HFKTQGQSLRQSNKRKGKKDHDAQRSKAPKSHydrophilic
NLS Segment(s)
PositionSequence
326-340KRKGKKDHDAQRSKA
Subcellular Location(s) nucl 13.5cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004854  Ufd1-like  
IPR042299  Ufd1-like_Nn  
Gene Ontology GO:0000837  C:Doa10p ubiquitin ligase complex  
GO:0000839  C:Hrd1p ubiquitin ligase ERAD-L complex  
GO:0005634  C:nucleus  
GO:0030894  C:replisome  
GO:1990112  C:RQC complex  
GO:0034098  C:VCP-NPL4-UFD1 AAA ATPase complex  
GO:0031593  F:polyubiquitin modification-dependent protein binding  
GO:0043130  F:ubiquitin binding  
GO:0071629  P:cytoplasm protein quality control by the ubiquitin-proteasome system  
GO:0006274  P:DNA replication termination  
GO:0071712  P:ER-associated misfolded protein catabolic process  
GO:0072671  P:mitochondria-associated ubiquitin-dependent protein catabolic process  
GO:0070651  P:nonfunctional rRNA decay  
GO:1900182  P:positive regulation of protein localization to nucleus  
GO:0072665  P:protein localization to vacuole  
GO:0030970  P:retrograde protein transport, ER to cytosol  
GO:1990116  P:ribosome-associated ubiquitin-dependent protein catabolic process  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
KEGG ago:AGOS_AFR662C  -  
Pfam View protein in Pfam  
PF03152  UFD1  
Amino Acid Sequences MFSGFGSFGGGFVPMPQKFEDFFRCYPIEMMNDRIRKEDANYGGKIFLPPSALNKLSMLNIRYPMLFKLSSQETGKVTHGGVLEFVAEEGRAYLPGWMMATLGVNPGSLLRISSTDVPQGQFVKIEPQSVDFLDISDPKAVLENVLRKFSTLTVDDIIEISYNKRIYRIRVLEVKPESECKSICVIETDLVTDFAPPVGYVEPDYQAANNNTQRKKKNTVDPASVSNGTMSRRIKYADIVKEAEQSATSFAGEGHKLSGKVVSAKDDIREIKISLDGKPAPLNLPEGQLFFGFPMVLPKEESEDQEGSQPNPHFKTQGQSLRQSNKRKGKKDHDAQRSKAPKSPEIIHID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.2
4 0.22
5 0.23
6 0.29
7 0.34
8 0.34
9 0.34
10 0.38
11 0.38
12 0.37
13 0.37
14 0.35
15 0.33
16 0.29
17 0.34
18 0.36
19 0.4
20 0.4
21 0.41
22 0.4
23 0.35
24 0.36
25 0.37
26 0.37
27 0.38
28 0.39
29 0.37
30 0.36
31 0.35
32 0.33
33 0.25
34 0.19
35 0.16
36 0.16
37 0.19
38 0.24
39 0.24
40 0.24
41 0.25
42 0.25
43 0.25
44 0.28
45 0.25
46 0.23
47 0.24
48 0.24
49 0.24
50 0.24
51 0.22
52 0.21
53 0.2
54 0.16
55 0.2
56 0.22
57 0.26
58 0.27
59 0.29
60 0.26
61 0.28
62 0.29
63 0.25
64 0.22
65 0.21
66 0.2
67 0.16
68 0.15
69 0.12
70 0.11
71 0.09
72 0.09
73 0.06
74 0.05
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.07
88 0.06
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.08
100 0.11
101 0.12
102 0.15
103 0.16
104 0.17
105 0.18
106 0.19
107 0.17
108 0.15
109 0.14
110 0.18
111 0.17
112 0.19
113 0.16
114 0.17
115 0.18
116 0.18
117 0.19
118 0.12
119 0.12
120 0.12
121 0.12
122 0.11
123 0.11
124 0.1
125 0.08
126 0.1
127 0.09
128 0.09
129 0.12
130 0.17
131 0.18
132 0.21
133 0.21
134 0.2
135 0.2
136 0.2
137 0.2
138 0.14
139 0.14
140 0.13
141 0.13
142 0.13
143 0.12
144 0.11
145 0.08
146 0.07
147 0.06
148 0.09
149 0.1
150 0.1
151 0.14
152 0.15
153 0.19
154 0.27
155 0.29
156 0.3
157 0.37
158 0.39
159 0.42
160 0.42
161 0.4
162 0.31
163 0.32
164 0.3
165 0.23
166 0.22
167 0.17
168 0.18
169 0.17
170 0.16
171 0.15
172 0.13
173 0.12
174 0.12
175 0.11
176 0.09
177 0.09
178 0.09
179 0.07
180 0.06
181 0.05
182 0.05
183 0.04
184 0.05
185 0.05
186 0.05
187 0.06
188 0.08
189 0.08
190 0.09
191 0.1
192 0.09
193 0.12
194 0.13
195 0.18
196 0.23
197 0.3
198 0.35
199 0.42
200 0.48
201 0.5
202 0.57
203 0.59
204 0.63
205 0.65
206 0.66
207 0.65
208 0.62
209 0.59
210 0.55
211 0.48
212 0.38
213 0.29
214 0.24
215 0.19
216 0.22
217 0.21
218 0.17
219 0.18
220 0.2
221 0.2
222 0.23
223 0.3
224 0.3
225 0.33
226 0.34
227 0.34
228 0.35
229 0.35
230 0.3
231 0.22
232 0.16
233 0.14
234 0.11
235 0.1
236 0.07
237 0.07
238 0.1
239 0.1
240 0.1
241 0.11
242 0.13
243 0.13
244 0.13
245 0.15
246 0.13
247 0.17
248 0.18
249 0.2
250 0.2
251 0.22
252 0.22
253 0.26
254 0.26
255 0.25
256 0.26
257 0.22
258 0.21
259 0.25
260 0.25
261 0.21
262 0.26
263 0.24
264 0.23
265 0.25
266 0.25
267 0.22
268 0.22
269 0.24
270 0.19
271 0.21
272 0.21
273 0.2
274 0.2
275 0.18
276 0.17
277 0.13
278 0.12
279 0.08
280 0.07
281 0.12
282 0.13
283 0.14
284 0.15
285 0.15
286 0.21
287 0.23
288 0.25
289 0.24
290 0.24
291 0.24
292 0.29
293 0.3
294 0.26
295 0.31
296 0.31
297 0.33
298 0.35
299 0.36
300 0.33
301 0.32
302 0.38
303 0.41
304 0.48
305 0.47
306 0.52
307 0.59
308 0.66
309 0.73
310 0.76
311 0.77
312 0.78
313 0.83
314 0.84
315 0.86
316 0.87
317 0.89
318 0.9
319 0.9
320 0.9
321 0.9
322 0.85
323 0.85
324 0.83
325 0.76
326 0.7
327 0.66
328 0.6
329 0.57
330 0.58