Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SEF2

Protein Details
Accession A0A4Y7SEF2   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
108-135GPSSNGTRRRLSRRPPPRRVLRTHTRVEHydrophilic
NLS Segment(s)
PositionSequence
115-127RRRLSRRPPPRRV
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPYRFPLFKARVSTLNIQSYNGREAFKCTTNGGAYVVNGTFNGTQNNGPVYPPSSQGNSSDRGQPGYAPSHFEGPPQESPEADVAAGHPDPTRPADTSAPTGTVQQPGPSSNGTRRRLSRRPPPRRVLRTHTRVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.48
4 0.43
5 0.42
6 0.4
7 0.39
8 0.34
9 0.28
10 0.21
11 0.26
12 0.28
13 0.29
14 0.28
15 0.24
16 0.26
17 0.25
18 0.25
19 0.22
20 0.18
21 0.15
22 0.15
23 0.14
24 0.1
25 0.09
26 0.1
27 0.1
28 0.1
29 0.11
30 0.11
31 0.11
32 0.12
33 0.14
34 0.12
35 0.11
36 0.11
37 0.13
38 0.12
39 0.14
40 0.15
41 0.15
42 0.15
43 0.18
44 0.2
45 0.21
46 0.21
47 0.23
48 0.22
49 0.21
50 0.21
51 0.18
52 0.18
53 0.18
54 0.17
55 0.15
56 0.15
57 0.18
58 0.18
59 0.18
60 0.18
61 0.18
62 0.2
63 0.2
64 0.19
65 0.16
66 0.17
67 0.17
68 0.16
69 0.11
70 0.09
71 0.07
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.09
78 0.12
79 0.14
80 0.12
81 0.16
82 0.18
83 0.2
84 0.24
85 0.23
86 0.23
87 0.21
88 0.23
89 0.21
90 0.22
91 0.2
92 0.18
93 0.19
94 0.18
95 0.2
96 0.19
97 0.22
98 0.27
99 0.36
100 0.39
101 0.45
102 0.51
103 0.59
104 0.66
105 0.71
106 0.74
107 0.76
108 0.82
109 0.85
110 0.88
111 0.89
112 0.89
113 0.89
114 0.87
115 0.87