Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TWJ5

Protein Details
Accession A0A4Y7TWJ5    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-119EEEERKRPTKKAKAVKNGKPSSBasic
NLS Segment(s)
PositionSequence
102-157RKRPTKKAKAVKNGKPSSDEVLARKLSSELNGRPSRAGAKSSTKARSTKKSAKKSA
172-184SEKKPKRSGGGGG
Subcellular Location(s) nucl 21, cyto_nucl 13.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014876  DEK_C  
IPR019835  SWIB_domain  
IPR036885  SWIB_MDM2_dom_sf  
IPR003121  SWIB_MDM2_domain  
Pfam View protein in Pfam  
PF02201  SWIB  
PROSITE View protein in PROSITE  
PS51998  DEK_C  
PS51925  SWIB_MDM2  
CDD cd10567  SWIB-MDM2_like  
Amino Acid Sequences MAPNLDSLEPKVLRILKAPGTDLSTISAKRVRRQLLELDSTLTPEFLKENKEEVDAIISRVFEQVNSGDNGADEAESSDSGSRKKRKGGDDDDEDGEEEEERKRPTKKAKAVKNGKPSSDEVLARKLSSELNGRPSRAGAKSSTKARSTKKSAKKSAATIDSGGEGGSESGSEKKPKRSGGGGGGFKKEFVLSEPLAAIIEVDKLSRPQVVKQLWVYIKGNELQNPDNKREIMCDSKMRAVFGVDKIDMFQMNKVLGKHLHEPEEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.33
4 0.35
5 0.37
6 0.32
7 0.33
8 0.32
9 0.29
10 0.27
11 0.25
12 0.22
13 0.24
14 0.27
15 0.26
16 0.32
17 0.4
18 0.43
19 0.43
20 0.47
21 0.52
22 0.54
23 0.56
24 0.49
25 0.44
26 0.38
27 0.36
28 0.32
29 0.24
30 0.16
31 0.12
32 0.13
33 0.12
34 0.16
35 0.15
36 0.19
37 0.2
38 0.21
39 0.21
40 0.19
41 0.22
42 0.19
43 0.19
44 0.17
45 0.15
46 0.14
47 0.15
48 0.15
49 0.09
50 0.11
51 0.1
52 0.12
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.1
59 0.08
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.13
68 0.21
69 0.28
70 0.31
71 0.38
72 0.45
73 0.5
74 0.58
75 0.63
76 0.63
77 0.62
78 0.62
79 0.56
80 0.49
81 0.42
82 0.33
83 0.25
84 0.17
85 0.11
86 0.09
87 0.11
88 0.12
89 0.17
90 0.19
91 0.25
92 0.35
93 0.44
94 0.53
95 0.59
96 0.67
97 0.73
98 0.8
99 0.82
100 0.83
101 0.76
102 0.68
103 0.62
104 0.54
105 0.47
106 0.41
107 0.35
108 0.26
109 0.27
110 0.26
111 0.22
112 0.21
113 0.18
114 0.14
115 0.14
116 0.17
117 0.14
118 0.23
119 0.24
120 0.24
121 0.24
122 0.24
123 0.25
124 0.22
125 0.22
126 0.17
127 0.21
128 0.25
129 0.31
130 0.35
131 0.35
132 0.4
133 0.44
134 0.48
135 0.51
136 0.57
137 0.61
138 0.67
139 0.7
140 0.72
141 0.7
142 0.66
143 0.64
144 0.58
145 0.49
146 0.4
147 0.33
148 0.26
149 0.22
150 0.17
151 0.1
152 0.06
153 0.05
154 0.04
155 0.04
156 0.04
157 0.07
158 0.09
159 0.16
160 0.19
161 0.27
162 0.32
163 0.35
164 0.38
165 0.39
166 0.41
167 0.43
168 0.48
169 0.48
170 0.45
171 0.46
172 0.42
173 0.38
174 0.34
175 0.26
176 0.18
177 0.14
178 0.16
179 0.13
180 0.14
181 0.14
182 0.14
183 0.14
184 0.13
185 0.1
186 0.05
187 0.06
188 0.06
189 0.06
190 0.07
191 0.08
192 0.09
193 0.13
194 0.14
195 0.16
196 0.25
197 0.26
198 0.31
199 0.31
200 0.39
201 0.36
202 0.4
203 0.38
204 0.31
205 0.32
206 0.31
207 0.33
208 0.28
209 0.31
210 0.3
211 0.36
212 0.4
213 0.41
214 0.41
215 0.39
216 0.36
217 0.35
218 0.37
219 0.36
220 0.37
221 0.4
222 0.39
223 0.45
224 0.46
225 0.43
226 0.38
227 0.34
228 0.33
229 0.29
230 0.31
231 0.24
232 0.23
233 0.23
234 0.25
235 0.24
236 0.2
237 0.19
238 0.17
239 0.19
240 0.22
241 0.21
242 0.24
243 0.25
244 0.29
245 0.35
246 0.38
247 0.4