Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SAT9

Protein Details
Accession A0A4Y7SAT9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-40RNTEGRLNPRTEKKKRRRERIEGISASCHydrophilic
NLS Segment(s)
PositionSequence
21-32PRTEKKKRRRER
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MSKEKDELAPEGRNTEGRLNPRTEKKKRRRERIEGISASCAGYIALLCCPAFPISSRQCVEVCEDSWLRNTWQRRFSFVDWLVQSQADACLARRNPFRDRSGISL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.32
5 0.35
6 0.38
7 0.44
8 0.53
9 0.61
10 0.65
11 0.71
12 0.75
13 0.82
14 0.87
15 0.91
16 0.91
17 0.91
18 0.91
19 0.9
20 0.88
21 0.8
22 0.71
23 0.62
24 0.52
25 0.42
26 0.3
27 0.2
28 0.1
29 0.07
30 0.06
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.13
41 0.15
42 0.21
43 0.21
44 0.22
45 0.22
46 0.23
47 0.26
48 0.22
49 0.2
50 0.18
51 0.18
52 0.17
53 0.19
54 0.2
55 0.18
56 0.21
57 0.27
58 0.29
59 0.37
60 0.38
61 0.41
62 0.46
63 0.46
64 0.5
65 0.45
66 0.46
67 0.39
68 0.4
69 0.35
70 0.29
71 0.27
72 0.18
73 0.17
74 0.11
75 0.11
76 0.1
77 0.17
78 0.19
79 0.26
80 0.32
81 0.37
82 0.43
83 0.5
84 0.53
85 0.53