Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SGM7

Protein Details
Accession A0A4Y7SGM7   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-92GERNKKEEGKKERERRRGKKTAABasic
123-152PRTPTPASQSRRPPRRKTPATPLLRRRPSVHydrophilic
NLS Segment(s)
PositionSequence
53-170RRSHSARRRPAASTQRLGERNKKEEGKKERERRRGKKTAAPARKSPRPRTPSTSSPRTSSTPPSARPRRPPRTPTPASQSRRPPRRKTPATPLLRRRPSVSTTRRVASRRISARSPPR
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MGWDLMMIVPPLLIPTPNQCCQLISRPSVSARRPSARRCCSTLPYRAHLDSGRRSHSARRRPAASTQRLGERNKKEEGKKERERRRGKKTAAPARKSPRPRTPSTSSPRTSSTPPSARPRRPPRTPTPASQSRRPPRRKTPATPLLRRRPSVSTTRRVASRRISARSPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.16
3 0.23
4 0.26
5 0.29
6 0.29
7 0.3
8 0.34
9 0.41
10 0.39
11 0.36
12 0.35
13 0.35
14 0.4
15 0.45
16 0.45
17 0.44
18 0.45
19 0.51
20 0.54
21 0.61
22 0.67
23 0.68
24 0.69
25 0.67
26 0.65
27 0.63
28 0.64
29 0.64
30 0.58
31 0.54
32 0.54
33 0.49
34 0.46
35 0.42
36 0.41
37 0.4
38 0.39
39 0.39
40 0.36
41 0.37
42 0.43
43 0.49
44 0.53
45 0.54
46 0.55
47 0.54
48 0.55
49 0.63
50 0.64
51 0.61
52 0.55
53 0.48
54 0.49
55 0.51
56 0.52
57 0.51
58 0.48
59 0.45
60 0.47
61 0.51
62 0.48
63 0.52
64 0.58
65 0.59
66 0.63
67 0.69
68 0.73
69 0.78
70 0.84
71 0.84
72 0.85
73 0.84
74 0.78
75 0.75
76 0.76
77 0.76
78 0.75
79 0.7
80 0.68
81 0.67
82 0.71
83 0.72
84 0.69
85 0.69
86 0.66
87 0.67
88 0.66
89 0.65
90 0.66
91 0.66
92 0.67
93 0.59
94 0.55
95 0.53
96 0.49
97 0.45
98 0.41
99 0.42
100 0.39
101 0.43
102 0.51
103 0.56
104 0.6
105 0.68
106 0.73
107 0.74
108 0.78
109 0.8
110 0.79
111 0.8
112 0.78
113 0.73
114 0.71
115 0.72
116 0.69
117 0.69
118 0.7
119 0.7
120 0.76
121 0.79
122 0.79
123 0.8
124 0.86
125 0.87
126 0.85
127 0.85
128 0.85
129 0.85
130 0.86
131 0.85
132 0.85
133 0.83
134 0.78
135 0.71
136 0.66
137 0.61
138 0.62
139 0.6
140 0.58
141 0.56
142 0.59
143 0.62
144 0.59
145 0.6
146 0.58
147 0.6
148 0.59
149 0.6
150 0.6