Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DEH3

Protein Details
Accession A5DEH3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
175-198VQNWRNYVHKVDKKTKKKKKKVLAHydrophilic
NLS Segment(s)
PositionSequence
186-197DKKTKKKKKKVL
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
KEGG pgu:PGUG_01674  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
CDD cd06257  DnaJ  
Amino Acid Sequences MEDLEKELSAQEAALSRDREIERVLSCASGDHFAVLDIWPGEDGKKAYRRKTILIHPDKTDNPQAPEAFDRLKKAERVVNAIKENDEEFYLERERLESIYKHVGFDNSKPETRSVATRDEAAKVLKREKAKLETDQSIERYQQEQENKRQMELQKQRLAKRKQDSVWEDQRDTRVQNWRNYVHKVDKKTKKKKKKVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.26
5 0.27
6 0.27
7 0.26
8 0.28
9 0.23
10 0.25
11 0.25
12 0.18
13 0.17
14 0.17
15 0.16
16 0.14
17 0.13
18 0.11
19 0.1
20 0.1
21 0.1
22 0.09
23 0.09
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.1
30 0.11
31 0.16
32 0.25
33 0.31
34 0.37
35 0.45
36 0.47
37 0.5
38 0.55
39 0.58
40 0.61
41 0.64
42 0.62
43 0.56
44 0.58
45 0.54
46 0.52
47 0.49
48 0.41
49 0.36
50 0.36
51 0.33
52 0.3
53 0.3
54 0.28
55 0.25
56 0.24
57 0.23
58 0.21
59 0.25
60 0.24
61 0.25
62 0.26
63 0.24
64 0.29
65 0.31
66 0.34
67 0.33
68 0.32
69 0.3
70 0.27
71 0.26
72 0.19
73 0.15
74 0.1
75 0.08
76 0.1
77 0.11
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.12
84 0.09
85 0.11
86 0.19
87 0.19
88 0.19
89 0.19
90 0.21
91 0.2
92 0.22
93 0.26
94 0.22
95 0.23
96 0.23
97 0.24
98 0.23
99 0.23
100 0.25
101 0.21
102 0.22
103 0.21
104 0.23
105 0.23
106 0.22
107 0.23
108 0.21
109 0.22
110 0.21
111 0.24
112 0.26
113 0.28
114 0.3
115 0.35
116 0.39
117 0.39
118 0.43
119 0.44
120 0.43
121 0.43
122 0.43
123 0.4
124 0.36
125 0.33
126 0.29
127 0.25
128 0.23
129 0.25
130 0.31
131 0.35
132 0.42
133 0.5
134 0.49
135 0.48
136 0.52
137 0.49
138 0.51
139 0.54
140 0.55
141 0.53
142 0.58
143 0.65
144 0.69
145 0.73
146 0.71
147 0.7
148 0.7
149 0.66
150 0.7
151 0.69
152 0.68
153 0.71
154 0.68
155 0.62
156 0.57
157 0.57
158 0.51
159 0.47
160 0.44
161 0.45
162 0.45
163 0.5
164 0.54
165 0.56
166 0.59
167 0.62
168 0.63
169 0.64
170 0.65
171 0.67
172 0.7
173 0.74
174 0.79
175 0.85
176 0.89
177 0.89
178 0.93