Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q74ZX7

Protein Details
Accession Q74ZX7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
105-130LARARSRTGRNILKRRREKGRWYLTHHydrophilic
NLS Segment(s)
PositionSequence
96-125LKRKRRVGFLARARSRTGRNILKRRREKGR
Subcellular Location(s) nucl 15, mito 8, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ago:AGOS_AGR081C  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLTAPSDEHTVLHYTIVAHRTMFSMYRSMLQWSSRRTIMTVVSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.19
4 0.17
5 0.14
6 0.15
7 0.15
8 0.16
9 0.17
10 0.14
11 0.15
12 0.15
13 0.17
14 0.18
15 0.2
16 0.2
17 0.24
18 0.27
19 0.28
20 0.31
21 0.3
22 0.3
23 0.28
24 0.27
25 0.25
26 0.23
27 0.24
28 0.25
29 0.26
30 0.26
31 0.25
32 0.24
33 0.22
34 0.2
35 0.2
36 0.24
37 0.25
38 0.26
39 0.28
40 0.28
41 0.28
42 0.27
43 0.22
44 0.14
45 0.1
46 0.07
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.05
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.1
67 0.15
68 0.17
69 0.2
70 0.23
71 0.27
72 0.32
73 0.43
74 0.51
75 0.57
76 0.63
77 0.63
78 0.69
79 0.67
80 0.67
81 0.66
82 0.64
83 0.64
84 0.65
85 0.71
86 0.66
87 0.71
88 0.74
89 0.73
90 0.75
91 0.75
92 0.77
93 0.73
94 0.72
95 0.67
96 0.62
97 0.58
98 0.55
99 0.54
100 0.53
101 0.58
102 0.67
103 0.73
104 0.79
105 0.85
106 0.86
107 0.87
108 0.86
109 0.86
110 0.86