Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SZ33

Protein Details
Accession A0A4Y7SZ33    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-39APQPCYEIRRPMRTRRRKIGRLQFLITHydrophilic
NLS Segment(s)
PositionSequence
25-30RTRRRK
Subcellular Location(s) nucl 12, mito 7, cyto 4, plas 2, extr 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MGACLPACLPCSAPQPCYEIRRPMRTRRRKIGRLQFLITQVTVTLAPSLVYPFSSTRVTHDARLASMNLRRRPMWVSKRKSSAEAFIKHRTDSEAATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.35
4 0.4
5 0.41
6 0.44
7 0.48
8 0.57
9 0.61
10 0.67
11 0.73
12 0.77
13 0.81
14 0.82
15 0.86
16 0.83
17 0.87
18 0.87
19 0.86
20 0.81
21 0.74
22 0.66
23 0.58
24 0.51
25 0.4
26 0.29
27 0.19
28 0.14
29 0.11
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.06
39 0.06
40 0.09
41 0.11
42 0.11
43 0.14
44 0.19
45 0.21
46 0.21
47 0.24
48 0.22
49 0.21
50 0.22
51 0.2
52 0.18
53 0.21
54 0.28
55 0.29
56 0.31
57 0.31
58 0.32
59 0.36
60 0.43
61 0.49
62 0.51
63 0.55
64 0.61
65 0.69
66 0.69
67 0.69
68 0.62
69 0.6
70 0.59
71 0.57
72 0.55
73 0.56
74 0.56
75 0.51
76 0.49
77 0.44
78 0.38