Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SGN0

Protein Details
Accession A0A4Y7SGN0   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-28KSSRSNSRAARRKASKHAKRSTSSHydrophilic
NLS Segment(s)
PositionSequence
10-24NSRAARRKASKHAKR
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSLGKSSRSNSRAARRKASKHAKRSTSSSSPASDHTAVQNFMNTSEAKAIEESFRDCVADYPDEVDMEAVYWVMAWRAVTQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.75
4 0.79
5 0.82
6 0.81
7 0.81
8 0.84
9 0.81
10 0.76
11 0.75
12 0.72
13 0.66
14 0.61
15 0.53
16 0.46
17 0.39
18 0.37
19 0.36
20 0.28
21 0.23
22 0.21
23 0.2
24 0.18
25 0.17
26 0.17
27 0.12
28 0.11
29 0.12
30 0.1
31 0.08
32 0.09
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.12
45 0.14
46 0.14
47 0.13
48 0.13
49 0.14
50 0.14
51 0.13
52 0.12
53 0.08
54 0.07
55 0.07
56 0.05
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06