Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7RDG5

Protein Details
Accession A0A4Y7RDG5   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-90HHPTWIHRDNQWRQRRRNKHFQYNRNGDKANHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 4, mito 3, extr 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MPHQELSDAKFMCPCLPRPTLRTSFSAFLHTTTFMNLILSFLYGPTVGSVWVVPVERPTHHPTWIHRDNQWRQRRRNKHFQYNRNGDKANDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.33
4 0.36
5 0.38
6 0.45
7 0.47
8 0.46
9 0.46
10 0.43
11 0.41
12 0.38
13 0.38
14 0.31
15 0.25
16 0.24
17 0.21
18 0.17
19 0.15
20 0.14
21 0.1
22 0.1
23 0.08
24 0.07
25 0.06
26 0.06
27 0.05
28 0.04
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.07
42 0.09
43 0.1
44 0.15
45 0.21
46 0.22
47 0.25
48 0.28
49 0.31
50 0.39
51 0.45
52 0.43
53 0.42
54 0.5
55 0.57
56 0.64
57 0.7
58 0.69
59 0.73
60 0.8
61 0.87
62 0.86
63 0.88
64 0.88
65 0.89
66 0.91
67 0.91
68 0.91
69 0.91
70 0.89
71 0.85
72 0.77