Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T819

Protein Details
Accession A0A4Y7T819    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
35-55YSKGRILGHKRAKRNSRPNTTHydrophilic
NLS Segment(s)
PositionSequence
43-48HKRAKR
Subcellular Location(s) mito 21, cyto_mito 13.333, cyto 3.5, cyto_nucl 3.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MTISGFLGNGRTLLCKGPLPPPACADERFAVSRLYSKGRILGHKRAKRNSRPNTTLVQIEGVSTKEEAQFYLGKRVAYVYKAKREVQGSKVRVIWGRISRSHGSSGVVKSKFRSNIPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.19
4 0.25
5 0.31
6 0.32
7 0.33
8 0.33
9 0.36
10 0.36
11 0.35
12 0.33
13 0.27
14 0.28
15 0.28
16 0.26
17 0.22
18 0.2
19 0.23
20 0.21
21 0.24
22 0.23
23 0.22
24 0.26
25 0.28
26 0.36
27 0.38
28 0.46
29 0.52
30 0.57
31 0.64
32 0.68
33 0.74
34 0.76
35 0.81
36 0.8
37 0.79
38 0.76
39 0.72
40 0.66
41 0.58
42 0.49
43 0.38
44 0.29
45 0.2
46 0.16
47 0.13
48 0.1
49 0.09
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.11
57 0.11
58 0.18
59 0.19
60 0.17
61 0.17
62 0.19
63 0.18
64 0.18
65 0.26
66 0.24
67 0.3
68 0.35
69 0.36
70 0.39
71 0.43
72 0.44
73 0.44
74 0.48
75 0.43
76 0.42
77 0.42
78 0.4
79 0.37
80 0.35
81 0.35
82 0.31
83 0.34
84 0.33
85 0.38
86 0.38
87 0.38
88 0.38
89 0.32
90 0.29
91 0.29
92 0.31
93 0.33
94 0.33
95 0.32
96 0.31
97 0.38
98 0.4
99 0.39
100 0.45
101 0.43
102 0.52
103 0.57
104 0.59
105 0.53
106 0.5
107 0.48
108 0.37
109 0.35
110 0.26
111 0.2
112 0.16
113 0.15
114 0.14