Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SA86

Protein Details
Accession A0A4Y7SA86   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-39LFVLILIRRRRRRHPTPPSSLFQHydrophilic
NLS Segment(s)
PositionSequence
25-29RRRRR
Subcellular Location(s) plas 11, extr 7, mito 5, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYSLPIAVGILFVIIILFVLILIRRRRRRHPTPPSSLFQLLVGLRLRSSRQPAWCSSRLPRHFGVEETTSKLSELLGLVAALVSRATKVWEAEGAAGCFLGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.1
9 0.17
10 0.27
11 0.36
12 0.42
13 0.53
14 0.62
15 0.72
16 0.77
17 0.82
18 0.83
19 0.84
20 0.84
21 0.77
22 0.73
23 0.63
24 0.52
25 0.41
26 0.34
27 0.23
28 0.2
29 0.18
30 0.12
31 0.12
32 0.12
33 0.14
34 0.13
35 0.19
36 0.2
37 0.24
38 0.27
39 0.3
40 0.36
41 0.38
42 0.38
43 0.39
44 0.45
45 0.43
46 0.44
47 0.42
48 0.39
49 0.38
50 0.35
51 0.33
52 0.27
53 0.26
54 0.25
55 0.25
56 0.2
57 0.19
58 0.18
59 0.14
60 0.12
61 0.1
62 0.07
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.07
74 0.09
75 0.1
76 0.11
77 0.13
78 0.14
79 0.17
80 0.2
81 0.19
82 0.17
83 0.16