Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SY41

Protein Details
Accession A0A4Y7SY41    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
229-252TVLSKDDKKELKRAKKDGRLAEALHydrophilic
NLS Segment(s)
PositionSequence
236-261KKELKRAKKDGRLAEALARSSGKAEK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MSDTKRKRDDDDEAGPGSSKRREEEDLDTWVLPESANEIRGPTFLMHPSDPSALSINFNATSGKVVLHSLDKDLDSDEPVKILDRTPTDVAQVWVATRIAGSPTINIRTGTGEGKFLSCDKYGLVSADRDARGPQEEWTPVVFPDGMVAFMNMYEKYLSVDEVAGGALQLRGDSEEVGFRERFWAKIQYKYKKEAHEEEKKRKDGASGPSAADETTANKLYQTWGAGRTVLSKDDKKELKRAKKDGRLAEALARSSGKAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.37
4 0.34
5 0.31
6 0.27
7 0.25
8 0.28
9 0.32
10 0.36
11 0.42
12 0.42
13 0.42
14 0.42
15 0.39
16 0.34
17 0.3
18 0.26
19 0.18
20 0.13
21 0.12
22 0.11
23 0.13
24 0.12
25 0.13
26 0.14
27 0.14
28 0.16
29 0.13
30 0.14
31 0.15
32 0.19
33 0.18
34 0.19
35 0.22
36 0.22
37 0.21
38 0.19
39 0.19
40 0.16
41 0.17
42 0.16
43 0.16
44 0.14
45 0.14
46 0.13
47 0.11
48 0.12
49 0.11
50 0.1
51 0.09
52 0.09
53 0.1
54 0.12
55 0.13
56 0.13
57 0.14
58 0.14
59 0.13
60 0.14
61 0.13
62 0.13
63 0.13
64 0.12
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.13
71 0.14
72 0.18
73 0.19
74 0.2
75 0.2
76 0.21
77 0.2
78 0.17
79 0.15
80 0.11
81 0.1
82 0.1
83 0.08
84 0.07
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.1
91 0.13
92 0.14
93 0.14
94 0.13
95 0.14
96 0.15
97 0.15
98 0.13
99 0.12
100 0.11
101 0.12
102 0.12
103 0.11
104 0.12
105 0.1
106 0.1
107 0.09
108 0.1
109 0.1
110 0.1
111 0.11
112 0.08
113 0.09
114 0.13
115 0.13
116 0.12
117 0.12
118 0.12
119 0.13
120 0.14
121 0.14
122 0.12
123 0.13
124 0.13
125 0.14
126 0.13
127 0.11
128 0.11
129 0.1
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.05
137 0.05
138 0.06
139 0.05
140 0.06
141 0.05
142 0.05
143 0.07
144 0.07
145 0.07
146 0.06
147 0.07
148 0.06
149 0.06
150 0.06
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.04
159 0.05
160 0.05
161 0.05
162 0.08
163 0.09
164 0.12
165 0.12
166 0.11
167 0.17
168 0.17
169 0.18
170 0.19
171 0.28
172 0.28
173 0.38
174 0.47
175 0.51
176 0.56
177 0.62
178 0.65
179 0.62
180 0.67
181 0.66
182 0.66
183 0.67
184 0.72
185 0.75
186 0.78
187 0.74
188 0.69
189 0.6
190 0.55
191 0.51
192 0.49
193 0.46
194 0.4
195 0.37
196 0.37
197 0.36
198 0.31
199 0.25
200 0.18
201 0.13
202 0.14
203 0.16
204 0.15
205 0.14
206 0.15
207 0.17
208 0.19
209 0.19
210 0.17
211 0.18
212 0.19
213 0.19
214 0.19
215 0.22
216 0.21
217 0.24
218 0.27
219 0.3
220 0.33
221 0.41
222 0.48
223 0.48
224 0.57
225 0.63
226 0.67
227 0.72
228 0.79
229 0.81
230 0.83
231 0.87
232 0.85
233 0.82
234 0.76
235 0.68
236 0.64
237 0.58
238 0.49
239 0.43
240 0.35
241 0.28