Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TB07

Protein Details
Accession A0A4Y7TB07    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPICHNRQARRRSEHPKVIIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 6, plas 4
Family & Domain DBs
Amino Acid Sequences MPICHNRQARRRSEHPKVIIACGLLGLIITGTIPSRRPEKITDWRLHVILSGRGSYPSASSDHGRAYRPFSRFQLEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.75
4 0.67
5 0.61
6 0.53
7 0.42
8 0.32
9 0.22
10 0.18
11 0.09
12 0.07
13 0.05
14 0.03
15 0.02
16 0.02
17 0.02
18 0.03
19 0.04
20 0.06
21 0.08
22 0.11
23 0.12
24 0.15
25 0.18
26 0.25
27 0.34
28 0.4
29 0.42
30 0.44
31 0.45
32 0.43
33 0.4
34 0.34
35 0.26
36 0.22
37 0.2
38 0.16
39 0.14
40 0.14
41 0.15
42 0.14
43 0.13
44 0.11
45 0.11
46 0.13
47 0.15
48 0.16
49 0.22
50 0.24
51 0.27
52 0.28
53 0.33
54 0.38
55 0.39
56 0.42
57 0.4