Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SNN5

Protein Details
Accession A0A4Y7SNN5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
131-155LVKAEKARRRAEKDHQSSVKRNRSFHydrophilic
NLS Segment(s)
PositionSequence
124-146KKKRVEGLVKAEKARRRAEKDHQ
Subcellular Location(s) mito_nucl 13.166, mito 13, nucl 12, cyto_mito 8.166, cyto_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
PROSITE View protein in PROSITE  
PS00745  RF_PROK_I  
Amino Acid Sequences MTETLNRVRQWVDRFKAVDATALRDANGIELTFSRSSGPGGQNVNKVNTKVTLRCDVDAPWIPPWAKGVLAENTHYTASSHSILVTSTNTRSQAQNIDDCLSKLRAIVLSASTTGLKNATPEEKKKRVEGLVKAEKARRRAEKDHQSSVKRNRSFKGYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.5
4 0.43
5 0.41
6 0.32
7 0.33
8 0.3
9 0.29
10 0.27
11 0.23
12 0.22
13 0.18
14 0.18
15 0.12
16 0.08
17 0.09
18 0.13
19 0.12
20 0.13
21 0.12
22 0.12
23 0.13
24 0.18
25 0.19
26 0.19
27 0.24
28 0.27
29 0.31
30 0.33
31 0.37
32 0.33
33 0.32
34 0.29
35 0.28
36 0.28
37 0.26
38 0.28
39 0.31
40 0.31
41 0.31
42 0.31
43 0.27
44 0.29
45 0.3
46 0.27
47 0.2
48 0.22
49 0.22
50 0.21
51 0.21
52 0.16
53 0.13
54 0.12
55 0.14
56 0.14
57 0.15
58 0.15
59 0.15
60 0.15
61 0.15
62 0.14
63 0.12
64 0.09
65 0.1
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.08
74 0.09
75 0.11
76 0.12
77 0.14
78 0.14
79 0.15
80 0.19
81 0.2
82 0.21
83 0.21
84 0.2
85 0.2
86 0.19
87 0.2
88 0.16
89 0.14
90 0.11
91 0.11
92 0.1
93 0.1
94 0.11
95 0.1
96 0.1
97 0.1
98 0.11
99 0.1
100 0.1
101 0.1
102 0.09
103 0.08
104 0.09
105 0.11
106 0.18
107 0.23
108 0.32
109 0.41
110 0.48
111 0.51
112 0.54
113 0.57
114 0.56
115 0.58
116 0.57
117 0.58
118 0.6
119 0.61
120 0.62
121 0.63
122 0.61
123 0.59
124 0.61
125 0.6
126 0.58
127 0.62
128 0.68
129 0.73
130 0.76
131 0.8
132 0.8
133 0.78
134 0.8
135 0.82
136 0.82
137 0.78
138 0.76
139 0.7