Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TNW1

Protein Details
Accession A0A4Y7TNW1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-84AWSPRRSRSSTPRRRRLRNPLSLNHydrophilic
NLS Segment(s)
PositionSequence
66-76RSRSSTPRRRR
Subcellular Location(s) mito 12, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTSSTRSLPVLAPRPPLPDLSTLTRVHVPDHAPKVLVPRHADRAYQRCDTIDTLVASTPSAWSPRRSRSSTPRRRRLRNPLSLNGFAWRIASGYFAYFLCGWGDGVMATVLPHLMEDFNITFMTGSLFYAASTIGFLTGTFLLERILKQLGRISRTGTRTSLFPFYPSIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.41
4 0.34
5 0.32
6 0.32
7 0.33
8 0.37
9 0.33
10 0.34
11 0.36
12 0.34
13 0.31
14 0.31
15 0.28
16 0.31
17 0.35
18 0.33
19 0.29
20 0.3
21 0.36
22 0.35
23 0.37
24 0.33
25 0.33
26 0.4
27 0.41
28 0.43
29 0.43
30 0.47
31 0.47
32 0.45
33 0.41
34 0.34
35 0.35
36 0.33
37 0.28
38 0.23
39 0.18
40 0.16
41 0.16
42 0.15
43 0.13
44 0.11
45 0.1
46 0.08
47 0.11
48 0.11
49 0.16
50 0.21
51 0.3
52 0.37
53 0.4
54 0.46
55 0.53
56 0.63
57 0.69
58 0.75
59 0.77
60 0.79
61 0.83
62 0.86
63 0.86
64 0.85
65 0.84
66 0.79
67 0.76
68 0.72
69 0.65
70 0.56
71 0.46
72 0.37
73 0.26
74 0.2
75 0.13
76 0.08
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.06
83 0.08
84 0.07
85 0.08
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.04
92 0.05
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.08
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.1
131 0.1
132 0.11
133 0.14
134 0.14
135 0.15
136 0.21
137 0.26
138 0.28
139 0.3
140 0.32
141 0.36
142 0.4
143 0.42
144 0.39
145 0.35
146 0.34
147 0.37
148 0.38
149 0.31
150 0.29