Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SQA4

Protein Details
Accession A0A4Y7SQA4   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
102-126PQPASRRRLRKATPQPASRRRLRKAHydrophilic
NLS Segment(s)
PositionSequence
106-126SRRRLRKATPQPASRRRLRKA
Subcellular Location(s) extr 10, nucl 9, mito 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
Amino Acid Sequences MINLRSESAFRPVDLAALCIERNNQPTKKNGGQWDADIFFNGHAIGCNAISWAPAVVPGSLITPQQPSSAAHGQPLQPRVVKRFASAGCDNLVKVWGYREDPQPASRRRLRKATPQPASRRRLRKATPQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.13
4 0.14
5 0.14
6 0.13
7 0.15
8 0.16
9 0.21
10 0.28
11 0.31
12 0.32
13 0.38
14 0.45
15 0.49
16 0.51
17 0.53
18 0.5
19 0.47
20 0.46
21 0.45
22 0.39
23 0.32
24 0.26
25 0.21
26 0.15
27 0.14
28 0.12
29 0.07
30 0.05
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.09
54 0.09
55 0.14
56 0.18
57 0.18
58 0.18
59 0.19
60 0.22
61 0.25
62 0.26
63 0.23
64 0.21
65 0.23
66 0.25
67 0.29
68 0.27
69 0.24
70 0.29
71 0.27
72 0.31
73 0.31
74 0.28
75 0.24
76 0.24
77 0.23
78 0.17
79 0.17
80 0.11
81 0.1
82 0.11
83 0.12
84 0.15
85 0.2
86 0.25
87 0.29
88 0.31
89 0.37
90 0.43
91 0.46
92 0.51
93 0.55
94 0.59
95 0.6
96 0.67
97 0.68
98 0.7
99 0.76
100 0.78
101 0.8
102 0.81
103 0.85
104 0.85
105 0.86
106 0.85
107 0.84
108 0.79
109 0.8
110 0.76