Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SNS9

Protein Details
Accession A0A4Y7SNS9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
186-210GSPVIRPRSRNRSRHQQRPKAVSTIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 8, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007065  HPP  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04982  HPP  
Amino Acid Sequences MYSSGNVLRHLPTWASRWLGYRPPQAPTLPAPHGRPGPSPPPPPPQHLVWIWSWIGAFSGISVIQAVFGQARYFVDRGVTPIVPSYGATAVLVYGVIDSPLAQPRNVFFGTFIGSLVGVCITKLFLLLPQERFDELAWLAAALACATTIVLMQITKTAHPPAGATAFLPALDPVATRSRMVLHPCGSPVIRPRSRNRSRHQQRPKAVSTILVDPARSSGSAGTRGGGDRWWDAGGVGWGDVGEEVVRNVCPFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.29
4 0.31
5 0.33
6 0.39
7 0.43
8 0.49
9 0.47
10 0.47
11 0.48
12 0.46
13 0.45
14 0.41
15 0.41
16 0.38
17 0.4
18 0.4
19 0.42
20 0.45
21 0.44
22 0.42
23 0.41
24 0.44
25 0.47
26 0.5
27 0.5
28 0.55
29 0.56
30 0.59
31 0.57
32 0.51
33 0.49
34 0.45
35 0.43
36 0.34
37 0.34
38 0.28
39 0.24
40 0.21
41 0.15
42 0.14
43 0.11
44 0.09
45 0.05
46 0.06
47 0.05
48 0.05
49 0.06
50 0.05
51 0.05
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.1
60 0.1
61 0.1
62 0.11
63 0.11
64 0.13
65 0.16
66 0.15
67 0.12
68 0.13
69 0.13
70 0.12
71 0.12
72 0.11
73 0.08
74 0.08
75 0.08
76 0.07
77 0.06
78 0.06
79 0.05
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.05
87 0.1
88 0.11
89 0.11
90 0.12
91 0.12
92 0.17
93 0.17
94 0.15
95 0.11
96 0.11
97 0.13
98 0.13
99 0.12
100 0.08
101 0.07
102 0.07
103 0.07
104 0.06
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.09
114 0.12
115 0.13
116 0.15
117 0.16
118 0.16
119 0.16
120 0.15
121 0.13
122 0.1
123 0.09
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.03
130 0.03
131 0.02
132 0.03
133 0.02
134 0.03
135 0.02
136 0.02
137 0.03
138 0.03
139 0.03
140 0.06
141 0.07
142 0.07
143 0.09
144 0.1
145 0.11
146 0.11
147 0.11
148 0.11
149 0.12
150 0.12
151 0.1
152 0.1
153 0.09
154 0.09
155 0.09
156 0.06
157 0.05
158 0.05
159 0.05
160 0.07
161 0.11
162 0.12
163 0.12
164 0.13
165 0.16
166 0.19
167 0.23
168 0.26
169 0.24
170 0.24
171 0.25
172 0.27
173 0.25
174 0.24
175 0.28
176 0.33
177 0.37
178 0.42
179 0.5
180 0.58
181 0.68
182 0.74
183 0.74
184 0.76
185 0.79
186 0.85
187 0.87
188 0.86
189 0.86
190 0.85
191 0.81
192 0.74
193 0.65
194 0.59
195 0.5
196 0.44
197 0.41
198 0.33
199 0.29
200 0.24
201 0.25
202 0.22
203 0.18
204 0.15
205 0.12
206 0.14
207 0.18
208 0.18
209 0.17
210 0.18
211 0.19
212 0.19
213 0.18
214 0.18
215 0.15
216 0.17
217 0.17
218 0.15
219 0.14
220 0.15
221 0.15
222 0.12
223 0.11
224 0.09
225 0.08
226 0.08
227 0.08
228 0.07
229 0.05
230 0.05
231 0.06
232 0.07
233 0.08