Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TPE4

Protein Details
Accession A0A4Y7TPE4   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
147-170HMDSRSRPFKPPRARSPSRLSRRSHydrophilic
NLS Segment(s)
PositionSequence
153-165RPFKPPRARSPSR
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039604  Bfr1  
Amino Acid Sequences MPAPKSSAASTANKAGAKPKTASSSGTATPVSSADKDTSDIAIATLTGGRPDKKTYDTQQEQIKKDIDALQVRLSTVREKISLATGKSGPGNDRRQELRQELDAIRSQQSQGKQFRSKTIEQVKALQDGVQQKVWLSHLVERDRPAHMDSRSRPFKPPRARSPSRLSRRSMPTSSASSPFRFPVPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.38
4 0.37
5 0.36
6 0.35
7 0.36
8 0.37
9 0.38
10 0.34
11 0.34
12 0.31
13 0.32
14 0.27
15 0.21
16 0.21
17 0.19
18 0.18
19 0.14
20 0.15
21 0.14
22 0.14
23 0.16
24 0.16
25 0.15
26 0.13
27 0.12
28 0.1
29 0.09
30 0.07
31 0.06
32 0.06
33 0.06
34 0.08
35 0.1
36 0.12
37 0.14
38 0.17
39 0.19
40 0.22
41 0.29
42 0.32
43 0.41
44 0.43
45 0.46
46 0.52
47 0.57
48 0.55
49 0.53
50 0.48
51 0.38
52 0.36
53 0.35
54 0.31
55 0.26
56 0.25
57 0.24
58 0.23
59 0.23
60 0.21
61 0.18
62 0.15
63 0.14
64 0.14
65 0.12
66 0.12
67 0.13
68 0.16
69 0.18
70 0.17
71 0.18
72 0.17
73 0.17
74 0.17
75 0.17
76 0.15
77 0.19
78 0.24
79 0.23
80 0.27
81 0.29
82 0.3
83 0.34
84 0.34
85 0.29
86 0.25
87 0.27
88 0.24
89 0.24
90 0.23
91 0.2
92 0.2
93 0.18
94 0.18
95 0.17
96 0.2
97 0.25
98 0.29
99 0.35
100 0.39
101 0.4
102 0.46
103 0.49
104 0.47
105 0.49
106 0.52
107 0.51
108 0.47
109 0.51
110 0.46
111 0.42
112 0.4
113 0.32
114 0.27
115 0.25
116 0.26
117 0.21
118 0.19
119 0.17
120 0.19
121 0.19
122 0.18
123 0.15
124 0.17
125 0.23
126 0.27
127 0.3
128 0.31
129 0.32
130 0.31
131 0.31
132 0.29
133 0.28
134 0.28
135 0.34
136 0.36
137 0.44
138 0.51
139 0.51
140 0.57
141 0.6
142 0.67
143 0.69
144 0.74
145 0.74
146 0.77
147 0.81
148 0.81
149 0.82
150 0.83
151 0.83
152 0.79
153 0.74
154 0.73
155 0.75
156 0.75
157 0.68
158 0.61
159 0.56
160 0.56
161 0.54
162 0.51
163 0.47
164 0.42
165 0.41
166 0.39