Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TMS1

Protein Details
Accession A0A4Y7TMS1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAIKIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-43KKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFK
Subcellular Location(s) nucl 15.5, mito_nucl 12, mito 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTAMPKVRLASYAIPQTRHLLPNGLKKFVVNNVRELDILLMHNKTFAAEIAHNVSSRNRTTILERAKVLNIKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.89
5 0.88
6 0.86
7 0.84
8 0.76
9 0.66
10 0.6
11 0.57
12 0.57
13 0.57
14 0.57
15 0.52
16 0.5
17 0.51
18 0.55
19 0.59
20 0.6
21 0.6
22 0.61
23 0.7
24 0.79
25 0.83
26 0.76
27 0.75
28 0.71
29 0.68
30 0.66
31 0.62
32 0.63
33 0.66
34 0.69
35 0.63
36 0.58
37 0.52
38 0.43
39 0.37
40 0.28
41 0.21
42 0.18
43 0.22
44 0.22
45 0.23
46 0.23
47 0.25
48 0.25
49 0.24
50 0.21
51 0.19
52 0.21
53 0.3
54 0.31
55 0.29
56 0.26
57 0.26
58 0.27
59 0.29
60 0.33
61 0.24
62 0.26
63 0.26
64 0.27
65 0.27
66 0.26
67 0.19
68 0.13
69 0.13
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.19
86 0.21
87 0.22
88 0.22
89 0.2
90 0.2
91 0.25
92 0.33
93 0.37
94 0.37
95 0.38
96 0.38
97 0.41
98 0.43
99 0.39
100 0.39
101 0.33
102 0.3
103 0.35
104 0.37
105 0.35
106 0.34
107 0.39
108 0.33