Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TG24

Protein Details
Accession A0A4Y7TG24    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTGRRPRRQSRKKIGVNGREWAHydrophilic
NLS Segment(s)
PositionSequence
4-13RRPRRQSRKK
Subcellular Location(s) mito 20, mito_nucl 12.833, cyto_mito 11.333, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MTGRRPRRQSRKKIGVNGREWAFTSYGTASFAGNSKLEMVTRSRGHCVDNVPWRDGAGPWSDAAVFSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.82
4 0.78
5 0.68
6 0.58
7 0.5
8 0.41
9 0.32
10 0.22
11 0.19
12 0.13
13 0.12
14 0.11
15 0.11
16 0.09
17 0.09
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.1
27 0.14
28 0.17
29 0.19
30 0.22
31 0.22
32 0.24
33 0.25
34 0.27
35 0.29
36 0.35
37 0.36
38 0.35
39 0.34
40 0.33
41 0.31
42 0.28
43 0.23
44 0.18
45 0.15
46 0.14
47 0.15
48 0.14
49 0.13