Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SFR8

Protein Details
Accession A0A4Y7SFR8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAYCPRQPPPPQWRTPPRRSSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MAYCPRQPPPPQWRTPPRRSSVLSPAFSRAKFPSPTLDIPPPSDYSPKPSTTPSSRSSTPQVHCDVCTHSPTPIQAYRIPVYPSVRPSSTPAGREPARACREVQGSGPPTCSGLPVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.84
4 0.79
5 0.77
6 0.73
7 0.69
8 0.69
9 0.67
10 0.6
11 0.53
12 0.53
13 0.5
14 0.46
15 0.43
16 0.35
17 0.33
18 0.32
19 0.31
20 0.31
21 0.32
22 0.34
23 0.36
24 0.38
25 0.33
26 0.34
27 0.34
28 0.31
29 0.27
30 0.28
31 0.23
32 0.25
33 0.28
34 0.27
35 0.26
36 0.26
37 0.31
38 0.32
39 0.36
40 0.33
41 0.35
42 0.34
43 0.35
44 0.38
45 0.39
46 0.36
47 0.35
48 0.34
49 0.3
50 0.3
51 0.28
52 0.27
53 0.22
54 0.23
55 0.2
56 0.17
57 0.17
58 0.17
59 0.21
60 0.19
61 0.2
62 0.2
63 0.24
64 0.25
65 0.27
66 0.27
67 0.26
68 0.27
69 0.27
70 0.29
71 0.29
72 0.28
73 0.27
74 0.3
75 0.35
76 0.36
77 0.35
78 0.34
79 0.37
80 0.37
81 0.41
82 0.4
83 0.41
84 0.42
85 0.41
86 0.39
87 0.38
88 0.4
89 0.37
90 0.36
91 0.34
92 0.34
93 0.34
94 0.35
95 0.29
96 0.28
97 0.26
98 0.25