Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DNZ1

Protein Details
Accession A5DNZ1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-52ASPILHLRPSKRKSKKKPSVRWTEDTVHydrophilic
NLS Segment(s)
PositionSequence
33-43RPSKRKSKKKP
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG pgu:PGUG_04992  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MAQQGSSQMRPQGTSSVTQTTTETSASPILHLRPSKRKSKKKPSVRWTEDTVDNEHMNKKKTKICCIFHPQRQFDDGSSCESCSSSDSSSDGSDTEDSKPNAYEHQPHYKNQSKVPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.28
4 0.28
5 0.27
6 0.26
7 0.24
8 0.23
9 0.2
10 0.17
11 0.13
12 0.15
13 0.14
14 0.15
15 0.15
16 0.15
17 0.2
18 0.23
19 0.28
20 0.35
21 0.41
22 0.5
23 0.59
24 0.68
25 0.74
26 0.82
27 0.86
28 0.87
29 0.92
30 0.92
31 0.92
32 0.88
33 0.82
34 0.75
35 0.69
36 0.62
37 0.53
38 0.46
39 0.37
40 0.31
41 0.27
42 0.27
43 0.26
44 0.24
45 0.25
46 0.26
47 0.29
48 0.32
49 0.41
50 0.45
51 0.45
52 0.5
53 0.57
54 0.62
55 0.64
56 0.69
57 0.62
58 0.55
59 0.54
60 0.47
61 0.38
62 0.33
63 0.27
64 0.23
65 0.21
66 0.2
67 0.18
68 0.17
69 0.16
70 0.14
71 0.16
72 0.11
73 0.12
74 0.12
75 0.13
76 0.14
77 0.14
78 0.12
79 0.12
80 0.12
81 0.13
82 0.15
83 0.2
84 0.21
85 0.22
86 0.23
87 0.22
88 0.26
89 0.29
90 0.33
91 0.34
92 0.44
93 0.46
94 0.48
95 0.56
96 0.6
97 0.6