Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DLG8

Protein Details
Accession A5DLG8   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-74DGETAEKPEKKHKKRRRRQYEDEVPKEKSBasic
NLS Segment(s)
PositionSequence
51-63EKPEKKHKKRRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
KEGG pgu:PGUG_04119  -  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MAEEEKPPVSESIEDNKDDKKRTIDKVDDSVEDGAEKKPEAAVKNDGETAEKPEKKHKKRRRRQYEDEVPKEKSEDEGEDEEDEDDDGDEINDELADLDDEDDDDLAEIDPANIIPSGRRTRGKVIDFTKAAEKLKEEGKIEDDEGEDGEYGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.37
4 0.41
5 0.42
6 0.42
7 0.41
8 0.45
9 0.51
10 0.58
11 0.58
12 0.57
13 0.6
14 0.59
15 0.51
16 0.46
17 0.4
18 0.3
19 0.24
20 0.2
21 0.15
22 0.13
23 0.12
24 0.1
25 0.11
26 0.15
27 0.16
28 0.19
29 0.24
30 0.24
31 0.26
32 0.27
33 0.25
34 0.23
35 0.22
36 0.25
37 0.28
38 0.29
39 0.29
40 0.38
41 0.49
42 0.56
43 0.67
44 0.71
45 0.74
46 0.82
47 0.92
48 0.93
49 0.92
50 0.92
51 0.91
52 0.92
53 0.91
54 0.88
55 0.81
56 0.71
57 0.61
58 0.52
59 0.41
60 0.31
61 0.22
62 0.15
63 0.14
64 0.13
65 0.14
66 0.13
67 0.13
68 0.12
69 0.1
70 0.09
71 0.06
72 0.05
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.03
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.06
103 0.13
104 0.19
105 0.24
106 0.28
107 0.31
108 0.39
109 0.48
110 0.51
111 0.52
112 0.51
113 0.54
114 0.51
115 0.5
116 0.48
117 0.44
118 0.41
119 0.35
120 0.33
121 0.28
122 0.32
123 0.35
124 0.31
125 0.29
126 0.31
127 0.32
128 0.3
129 0.28
130 0.24
131 0.2
132 0.18
133 0.17
134 0.13