Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TZH0

Protein Details
Accession A0A4Y7TZH0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
231-256SESTPDGQPKKPRGRPKGSKNKKAASHydrophilic
NLS Segment(s)
PositionSequence
238-256QPKKPRGRPKGSKNKKAAS
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MSQHIPNHHPQQPQYVQYAGPSTPAYIQGVPAPIVAQPMHQAMHYQPQPQIQSPPPPALATSTSANGPQNSARGDWTKDLVQLAKQGELKKHALALQLHTAHILSAHASLDTKLKAIQDVKEQKNKLESERARLLKCLQEINMDRDQADLAQATLDRECDALRAKIQVLSDGEWAIAKADVDRLRADLGQEPLPSLQQTLEERRAAYLEERRRQGNEGENSAGSSGQKRPSESTPDGQPKKPRGRPKGSKNKKAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.45
3 0.39
4 0.36
5 0.37
6 0.26
7 0.23
8 0.2
9 0.17
10 0.17
11 0.19
12 0.19
13 0.16
14 0.17
15 0.17
16 0.18
17 0.17
18 0.16
19 0.14
20 0.12
21 0.14
22 0.13
23 0.11
24 0.12
25 0.13
26 0.13
27 0.13
28 0.14
29 0.13
30 0.23
31 0.25
32 0.26
33 0.26
34 0.32
35 0.35
36 0.36
37 0.4
38 0.35
39 0.4
40 0.41
41 0.41
42 0.37
43 0.34
44 0.32
45 0.29
46 0.26
47 0.21
48 0.19
49 0.17
50 0.16
51 0.18
52 0.2
53 0.17
54 0.17
55 0.16
56 0.17
57 0.17
58 0.17
59 0.18
60 0.19
61 0.21
62 0.21
63 0.22
64 0.2
65 0.2
66 0.21
67 0.19
68 0.17
69 0.2
70 0.19
71 0.2
72 0.22
73 0.24
74 0.25
75 0.28
76 0.29
77 0.25
78 0.25
79 0.23
80 0.25
81 0.23
82 0.24
83 0.25
84 0.24
85 0.23
86 0.22
87 0.2
88 0.15
89 0.14
90 0.11
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.08
98 0.08
99 0.08
100 0.09
101 0.09
102 0.12
103 0.13
104 0.15
105 0.22
106 0.31
107 0.35
108 0.41
109 0.42
110 0.4
111 0.44
112 0.43
113 0.37
114 0.37
115 0.34
116 0.33
117 0.4
118 0.43
119 0.37
120 0.37
121 0.37
122 0.3
123 0.31
124 0.26
125 0.18
126 0.21
127 0.23
128 0.27
129 0.28
130 0.25
131 0.23
132 0.21
133 0.21
134 0.14
135 0.13
136 0.07
137 0.05
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.09
148 0.1
149 0.11
150 0.12
151 0.12
152 0.15
153 0.15
154 0.16
155 0.15
156 0.16
157 0.16
158 0.14
159 0.14
160 0.11
161 0.11
162 0.08
163 0.07
164 0.06
165 0.05
166 0.11
167 0.12
168 0.14
169 0.14
170 0.15
171 0.16
172 0.16
173 0.17
174 0.16
175 0.17
176 0.19
177 0.18
178 0.18
179 0.17
180 0.18
181 0.17
182 0.13
183 0.11
184 0.12
185 0.16
186 0.22
187 0.26
188 0.27
189 0.27
190 0.27
191 0.27
192 0.25
193 0.26
194 0.29
195 0.34
196 0.4
197 0.43
198 0.45
199 0.46
200 0.48
201 0.47
202 0.47
203 0.44
204 0.41
205 0.41
206 0.38
207 0.36
208 0.34
209 0.29
210 0.21
211 0.19
212 0.19
213 0.24
214 0.27
215 0.29
216 0.33
217 0.38
218 0.46
219 0.47
220 0.47
221 0.5
222 0.58
223 0.61
224 0.63
225 0.67
226 0.68
227 0.74
228 0.78
229 0.78
230 0.78
231 0.84
232 0.88
233 0.9
234 0.91
235 0.92
236 0.93