Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DIL7

Protein Details
Accession A5DIL7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
154-183KFHEKTTPTKVTKPKKSQDDKAKGKKKARKBasic
NLS Segment(s)
PositionSequence
163-183KVTKPKKSQDDKAKGKKKARK
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
KEGG pgu:PGUG_03118  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MEDITKVESYLAALDSSIDTLEDTVKPILGKDMVSITEDLDPISRIKAYNNYLYVTISTLFAYLKSTGVKTESHPIMEELARIKKSMNKVKELEQKLQSKDTSAQDSETAKRLIQQALGNNVNGGGAAAPDSIKKPAISSASFKGSEFQGKHTKFHEKTTPTKVTKPKKSQDDKAKGKKKARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.07
6 0.06
7 0.06
8 0.09
9 0.08
10 0.1
11 0.1
12 0.12
13 0.11
14 0.12
15 0.14
16 0.13
17 0.13
18 0.12
19 0.14
20 0.13
21 0.15
22 0.14
23 0.13
24 0.13
25 0.13
26 0.12
27 0.1
28 0.11
29 0.1
30 0.11
31 0.11
32 0.09
33 0.12
34 0.18
35 0.21
36 0.26
37 0.27
38 0.27
39 0.27
40 0.27
41 0.25
42 0.19
43 0.16
44 0.11
45 0.09
46 0.08
47 0.08
48 0.07
49 0.09
50 0.08
51 0.09
52 0.09
53 0.1
54 0.1
55 0.12
56 0.12
57 0.12
58 0.2
59 0.19
60 0.19
61 0.19
62 0.19
63 0.19
64 0.18
65 0.17
66 0.13
67 0.15
68 0.15
69 0.15
70 0.15
71 0.17
72 0.25
73 0.32
74 0.32
75 0.34
76 0.36
77 0.44
78 0.52
79 0.52
80 0.5
81 0.48
82 0.5
83 0.46
84 0.48
85 0.4
86 0.33
87 0.33
88 0.3
89 0.28
90 0.23
91 0.21
92 0.21
93 0.23
94 0.23
95 0.21
96 0.19
97 0.15
98 0.18
99 0.2
100 0.18
101 0.19
102 0.2
103 0.2
104 0.26
105 0.27
106 0.24
107 0.21
108 0.2
109 0.17
110 0.14
111 0.1
112 0.04
113 0.03
114 0.03
115 0.04
116 0.04
117 0.05
118 0.07
119 0.08
120 0.09
121 0.1
122 0.1
123 0.14
124 0.18
125 0.2
126 0.23
127 0.25
128 0.3
129 0.3
130 0.29
131 0.27
132 0.25
133 0.3
134 0.27
135 0.29
136 0.34
137 0.35
138 0.39
139 0.41
140 0.5
141 0.44
142 0.51
143 0.54
144 0.5
145 0.56
146 0.62
147 0.68
148 0.62
149 0.69
150 0.71
151 0.73
152 0.78
153 0.8
154 0.8
155 0.81
156 0.86
157 0.88
158 0.89
159 0.89
160 0.89
161 0.9
162 0.9
163 0.89