Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DGJ7

Protein Details
Accession A5DGJ7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
169-193TAEERHKRFEEKRKQHYHMKALPLKBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.333, cyto 4, cyto_pero 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007062  PPI-2  
Gene Ontology GO:0004864  F:protein phosphatase inhibitor activity  
GO:0043666  P:regulation of phosphoprotein phosphatase activity  
GO:0009966  P:regulation of signal transduction  
KEGG pgu:PGUG_02398  -  
Pfam View protein in Pfam  
PF04979  IPP-2  
Amino Acid Sequences MSEPRGILRNKDEKRERRESADELDRKEVIRNTMLNANLASESSKGDEIRAKIAKARKSSTGNGADGNGNNEHLKWDEINLYKTEQEKCATMKIDEPKTPYTGGFNPDGEYYQEDEIDIPAFNLGESELDKQSAPQDSLNGGSIYVDPDQKYDEEESDDDKEEESKQLTAEERHKRFEEKRKQHYHMKALPLKQGVQLDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.75
4 0.72
5 0.73
6 0.67
7 0.64
8 0.65
9 0.61
10 0.55
11 0.54
12 0.48
13 0.42
14 0.43
15 0.38
16 0.31
17 0.31
18 0.28
19 0.28
20 0.31
21 0.31
22 0.27
23 0.24
24 0.22
25 0.17
26 0.16
27 0.14
28 0.1
29 0.1
30 0.1
31 0.12
32 0.11
33 0.13
34 0.17
35 0.18
36 0.25
37 0.26
38 0.25
39 0.29
40 0.35
41 0.39
42 0.4
43 0.42
44 0.42
45 0.44
46 0.47
47 0.49
48 0.48
49 0.43
50 0.38
51 0.36
52 0.31
53 0.26
54 0.26
55 0.18
56 0.14
57 0.13
58 0.12
59 0.12
60 0.11
61 0.11
62 0.09
63 0.1
64 0.14
65 0.15
66 0.17
67 0.17
68 0.18
69 0.19
70 0.22
71 0.22
72 0.19
73 0.18
74 0.18
75 0.18
76 0.21
77 0.19
78 0.17
79 0.2
80 0.25
81 0.28
82 0.28
83 0.3
84 0.28
85 0.28
86 0.28
87 0.23
88 0.2
89 0.18
90 0.19
91 0.17
92 0.16
93 0.15
94 0.15
95 0.15
96 0.13
97 0.12
98 0.12
99 0.1
100 0.1
101 0.09
102 0.09
103 0.08
104 0.08
105 0.07
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.08
115 0.08
116 0.09
117 0.09
118 0.09
119 0.12
120 0.14
121 0.14
122 0.12
123 0.13
124 0.13
125 0.15
126 0.16
127 0.13
128 0.1
129 0.1
130 0.09
131 0.1
132 0.11
133 0.12
134 0.11
135 0.11
136 0.13
137 0.13
138 0.15
139 0.15
140 0.15
141 0.16
142 0.16
143 0.19
144 0.2
145 0.22
146 0.19
147 0.18
148 0.18
149 0.16
150 0.18
151 0.16
152 0.14
153 0.13
154 0.16
155 0.19
156 0.23
157 0.31
158 0.39
159 0.41
160 0.47
161 0.49
162 0.54
163 0.6
164 0.65
165 0.67
166 0.67
167 0.75
168 0.79
169 0.83
170 0.85
171 0.85
172 0.85
173 0.8
174 0.8
175 0.77
176 0.71
177 0.72
178 0.66
179 0.59
180 0.53
181 0.5