Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SDU2

Protein Details
Accession A0A4Y7SDU2   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-97SPLLPTRSPPHRRRPRSRPRLEVKREMABasic
150-182RADSRASLRVRRTRKKERKERARRGGERRGEGGBasic
NLS Segment(s)
PositionSequence
77-99SPPHRRRPRSRPRLEVKREMAHK
154-188RASLRVRRTRKKERKERARRGGERRGEGGKRIREG
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKPRNRETKSTHLLLPRVQTTLILPFRSIPHQHTIRNYVCPLVPLSLPPRQIPDLEMGRQRCPSLPILSSPLLPTRSPPHRRRPRSRPRLEVKREMAHKTQPQIRHTRPLEKRTSGIPSHSSSVTAPRPRFRSANCCWILGRSARCWVRRADSRASLRVRRTRKKERKERARRGGERRGEGGKRIREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.44
4 0.38
5 0.34
6 0.29
7 0.25
8 0.3
9 0.3
10 0.25
11 0.23
12 0.24
13 0.27
14 0.32
15 0.33
16 0.28
17 0.33
18 0.38
19 0.41
20 0.45
21 0.5
22 0.47
23 0.49
24 0.46
25 0.39
26 0.34
27 0.31
28 0.27
29 0.21
30 0.18
31 0.16
32 0.2
33 0.22
34 0.24
35 0.23
36 0.26
37 0.25
38 0.25
39 0.23
40 0.25
41 0.25
42 0.26
43 0.31
44 0.3
45 0.31
46 0.32
47 0.31
48 0.26
49 0.25
50 0.24
51 0.22
52 0.2
53 0.2
54 0.23
55 0.23
56 0.22
57 0.2
58 0.2
59 0.19
60 0.18
61 0.18
62 0.21
63 0.3
64 0.39
65 0.45
66 0.53
67 0.62
68 0.72
69 0.8
70 0.84
71 0.85
72 0.87
73 0.89
74 0.87
75 0.86
76 0.87
77 0.84
78 0.81
79 0.74
80 0.69
81 0.65
82 0.59
83 0.52
84 0.47
85 0.44
86 0.4
87 0.4
88 0.4
89 0.41
90 0.46
91 0.45
92 0.49
93 0.49
94 0.54
95 0.55
96 0.58
97 0.59
98 0.52
99 0.51
100 0.44
101 0.47
102 0.38
103 0.35
104 0.31
105 0.27
106 0.27
107 0.26
108 0.23
109 0.18
110 0.23
111 0.27
112 0.31
113 0.31
114 0.35
115 0.39
116 0.42
117 0.45
118 0.43
119 0.45
120 0.43
121 0.51
122 0.46
123 0.44
124 0.4
125 0.38
126 0.37
127 0.34
128 0.32
129 0.24
130 0.31
131 0.35
132 0.38
133 0.39
134 0.39
135 0.42
136 0.47
137 0.51
138 0.5
139 0.53
140 0.57
141 0.62
142 0.65
143 0.63
144 0.64
145 0.67
146 0.7
147 0.71
148 0.75
149 0.79
150 0.83
151 0.88
152 0.9
153 0.92
154 0.93
155 0.95
156 0.96
157 0.95
158 0.96
159 0.94
160 0.92
161 0.91
162 0.89
163 0.83
164 0.76
165 0.74
166 0.66
167 0.64
168 0.64