Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SKA3

Protein Details
Accession A0A4Y7SKA3   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKRGWKRQRRERRRRKRGGESEEEESEBasic
41-69SEDEYPPRKKAKKGKAKAKVKAAKPKKATBasic
NLS Segment(s)
PositionSequence
2-18KRGWKRQRRERRRRKRG
47-79PRKKAKKGKAKAKVKAAKPKKATTTKTRAQKNS
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKRGWKRQRRERRRRKRGGESEEEESEEPEEWEPEEGDDGSEDEYPPRKKAKKGKAKAKVKAAKPKKATTTKTRAQKNSKGSTSKASSSGGHESALNEAKKQFTPGSLIYVREGGMGDWVAGKVVRVYSIRGTITVNWNPRLDDGKYDENPHADNVRNVQTAEEYLAGLSEGSGSGGRLSDSSRKHRARHARMSSAGIVLQKLGRRTREIHPATAQWYAEWQTKPLELIYMFCKYCPHQRRSSLHLCGIRMECFSLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.96
3 0.96
4 0.95
5 0.93
6 0.92
7 0.86
8 0.8
9 0.71
10 0.64
11 0.52
12 0.42
13 0.34
14 0.24
15 0.2
16 0.14
17 0.13
18 0.11
19 0.12
20 0.11
21 0.11
22 0.12
23 0.11
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.11
31 0.18
32 0.21
33 0.24
34 0.33
35 0.37
36 0.45
37 0.55
38 0.63
39 0.68
40 0.76
41 0.83
42 0.85
43 0.89
44 0.88
45 0.89
46 0.86
47 0.83
48 0.84
49 0.82
50 0.81
51 0.77
52 0.76
53 0.75
54 0.76
55 0.74
56 0.73
57 0.73
58 0.71
59 0.73
60 0.75
61 0.74
62 0.74
63 0.75
64 0.74
65 0.74
66 0.73
67 0.68
68 0.61
69 0.59
70 0.54
71 0.48
72 0.41
73 0.35
74 0.29
75 0.29
76 0.31
77 0.24
78 0.21
79 0.19
80 0.17
81 0.18
82 0.23
83 0.19
84 0.16
85 0.16
86 0.18
87 0.18
88 0.2
89 0.17
90 0.12
91 0.16
92 0.15
93 0.2
94 0.2
95 0.2
96 0.18
97 0.18
98 0.17
99 0.14
100 0.13
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.06
113 0.06
114 0.08
115 0.09
116 0.11
117 0.12
118 0.12
119 0.13
120 0.13
121 0.18
122 0.21
123 0.23
124 0.23
125 0.24
126 0.23
127 0.24
128 0.25
129 0.2
130 0.19
131 0.2
132 0.24
133 0.25
134 0.27
135 0.27
136 0.25
137 0.25
138 0.23
139 0.21
140 0.16
141 0.16
142 0.17
143 0.2
144 0.19
145 0.18
146 0.17
147 0.15
148 0.15
149 0.15
150 0.12
151 0.08
152 0.06
153 0.06
154 0.06
155 0.05
156 0.04
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.08
167 0.14
168 0.19
169 0.27
170 0.37
171 0.42
172 0.45
173 0.54
174 0.62
175 0.66
176 0.71
177 0.72
178 0.68
179 0.66
180 0.67
181 0.59
182 0.49
183 0.41
184 0.31
185 0.23
186 0.17
187 0.17
188 0.16
189 0.2
190 0.24
191 0.25
192 0.28
193 0.32
194 0.37
195 0.45
196 0.46
197 0.46
198 0.45
199 0.45
200 0.44
201 0.43
202 0.38
203 0.27
204 0.27
205 0.25
206 0.27
207 0.25
208 0.24
209 0.22
210 0.23
211 0.24
212 0.21
213 0.22
214 0.16
215 0.17
216 0.2
217 0.24
218 0.23
219 0.22
220 0.25
221 0.25
222 0.36
223 0.43
224 0.46
225 0.49
226 0.59
227 0.65
228 0.7
229 0.77
230 0.73
231 0.71
232 0.69
233 0.61
234 0.58
235 0.54
236 0.48
237 0.39
238 0.35