Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SKA3

Protein Details
Accession A0A4Y7SKA3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKRGWKRQRRERRRRKRGGESEEEESEBasic
41-69SEDEYPPRKKAKKGKAKAKVKAAKPKKATBasic
NLS Segment(s)
PositionSequence
2-18KRGWKRQRRERRRRKRG
47-79PRKKAKKGKAKAKVKAAKPKKATTTKTRAQKNS
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKRGWKRQRRERRRRKRGGESEEEESEEPEEWEPEEGDDGSEDEYPPRKKAKKGKAKAKVKAAKPKKATTTKTRAQKNSKGSTSKASSSGGHESALNEAKKQFTPGSLIYVREGGMGDWVAGKVVRVYSIRGTITVNWNPRLDDGKYDENPHADNVRNVQTAEEYLAGLSEGSGSGGRLSDSSRKHRARHARMSSAGIVLQKLGRRTREIHPATAQWYAEWQTKPLELIYMFCKYCPHQRRSSLHLCGIRMECFSLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.96
3 0.96
4 0.95
5 0.93
6 0.92
7 0.86
8 0.8
9 0.71
10 0.64
11 0.52
12 0.42
13 0.34
14 0.24
15 0.2
16 0.14
17 0.13
18 0.11
19 0.12
20 0.11
21 0.11
22 0.12
23 0.11
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.11
31 0.18
32 0.21
33 0.24
34 0.33
35 0.37
36 0.45
37 0.55
38 0.63
39 0.68
40 0.76
41 0.83
42 0.85
43 0.89
44 0.88
45 0.89
46 0.86
47 0.83
48 0.84
49 0.82
50 0.81
51 0.77
52 0.76
53 0.75
54 0.76
55 0.74
56 0.73
57 0.73
58 0.71
59 0.73
60 0.75
61 0.74
62 0.74
63 0.75
64 0.74
65 0.74
66 0.73
67 0.68
68 0.61
69 0.59
70 0.54
71 0.48
72 0.41
73 0.35
74 0.29
75 0.29
76 0.31
77 0.24
78 0.21
79 0.19
80 0.17
81 0.18
82 0.23
83 0.19
84 0.16
85 0.16
86 0.18
87 0.18
88 0.2
89 0.17
90 0.12
91 0.16
92 0.15
93 0.2
94 0.2
95 0.2
96 0.18
97 0.18
98 0.17
99 0.14
100 0.13
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.06
113 0.06
114 0.08
115 0.09
116 0.11
117 0.12
118 0.12
119 0.13
120 0.13
121 0.18
122 0.21
123 0.23
124 0.23
125 0.24
126 0.23
127 0.24
128 0.25
129 0.2
130 0.19
131 0.2
132 0.24
133 0.25
134 0.27
135 0.27
136 0.25
137 0.25
138 0.23
139 0.21
140 0.16
141 0.16
142 0.17
143 0.2
144 0.19
145 0.18
146 0.17
147 0.15
148 0.15
149 0.15
150 0.12
151 0.08
152 0.06
153 0.06
154 0.06
155 0.05
156 0.04
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.08
167 0.14
168 0.19
169 0.27
170 0.37
171 0.42
172 0.45
173 0.54
174 0.62
175 0.66
176 0.71
177 0.72
178 0.68
179 0.66
180 0.67
181 0.59
182 0.49
183 0.41
184 0.31
185 0.23
186 0.17
187 0.17
188 0.16
189 0.2
190 0.24
191 0.25
192 0.28
193 0.32
194 0.37
195 0.45
196 0.46
197 0.46
198 0.45
199 0.45
200 0.44
201 0.43
202 0.38
203 0.27
204 0.27
205 0.25
206 0.27
207 0.25
208 0.24
209 0.22
210 0.23
211 0.24
212 0.21
213 0.22
214 0.16
215 0.17
216 0.2
217 0.24
218 0.23
219 0.22
220 0.25
221 0.25
222 0.36
223 0.43
224 0.46
225 0.49
226 0.59
227 0.65
228 0.7
229 0.77
230 0.73
231 0.71
232 0.69
233 0.61
234 0.58
235 0.54
236 0.48
237 0.39
238 0.35