Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75DD4

Protein Details
Accession Q75DD4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
136-163LEPNKKTRIERREKARKRERMPANPRLDBasic
NLS Segment(s)
PositionSequence
119-157RRRSPPAEPARAEPVRELEPNKKTRIERREKARKRERMP
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
IPR045125  Sub1/Tcp4-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0005634  C:nucleus  
GO:0005667  C:transcription regulator complex  
GO:0003682  F:chromatin binding  
GO:0003677  F:DNA binding  
GO:0003713  F:transcription coactivator activity  
GO:0006303  P:double-strand break repair via nonhomologous end joining  
GO:0006972  P:hyperosmotic response  
GO:0075297  P:negative regulation of ascospore formation  
GO:0051053  P:negative regulation of DNA metabolic process  
GO:0045945  P:positive regulation of transcription by RNA polymerase III  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
GO:0070898  P:RNA polymerase III preinitiation complex assembly  
GO:0006369  P:termination of RNA polymerase II transcription  
KEGG ago:AGOS_ABR093C  -  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MSFNSFPSNQLYGAHRYSSAYNAVAVPDSGPGAGRYRKRKTQEAAEDNVFFELGKNKRVTVRQFRNINLVDIREYYQESATGEMKPGKKGISLTEEQYDELLQHRGQIDEALRSFGSARRRSPPAEPARAEPVRELEPNKKTRIERREKARKRERMPANPRLDNPRLDNPRLDDACPPRPAAHDDDDLNSSDEDFAQALESEVRRRDEDISEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.25
4 0.26
5 0.26
6 0.25
7 0.2
8 0.18
9 0.17
10 0.18
11 0.16
12 0.15
13 0.12
14 0.1
15 0.09
16 0.08
17 0.08
18 0.09
19 0.13
20 0.19
21 0.27
22 0.36
23 0.43
24 0.52
25 0.58
26 0.65
27 0.67
28 0.71
29 0.74
30 0.71
31 0.69
32 0.64
33 0.59
34 0.5
35 0.44
36 0.33
37 0.22
38 0.17
39 0.18
40 0.16
41 0.2
42 0.21
43 0.22
44 0.27
45 0.34
46 0.41
47 0.45
48 0.53
49 0.57
50 0.61
51 0.61
52 0.63
53 0.58
54 0.53
55 0.43
56 0.35
57 0.27
58 0.23
59 0.23
60 0.16
61 0.16
62 0.14
63 0.12
64 0.12
65 0.11
66 0.12
67 0.12
68 0.11
69 0.12
70 0.16
71 0.17
72 0.17
73 0.18
74 0.16
75 0.16
76 0.17
77 0.18
78 0.19
79 0.19
80 0.2
81 0.21
82 0.21
83 0.2
84 0.19
85 0.16
86 0.1
87 0.1
88 0.1
89 0.07
90 0.09
91 0.09
92 0.09
93 0.09
94 0.11
95 0.1
96 0.1
97 0.11
98 0.1
99 0.1
100 0.1
101 0.1
102 0.12
103 0.2
104 0.21
105 0.24
106 0.27
107 0.3
108 0.32
109 0.35
110 0.42
111 0.41
112 0.45
113 0.44
114 0.42
115 0.47
116 0.46
117 0.43
118 0.34
119 0.29
120 0.25
121 0.26
122 0.26
123 0.26
124 0.33
125 0.37
126 0.39
127 0.42
128 0.43
129 0.5
130 0.58
131 0.61
132 0.61
133 0.67
134 0.76
135 0.79
136 0.86
137 0.87
138 0.86
139 0.81
140 0.83
141 0.83
142 0.82
143 0.82
144 0.81
145 0.8
146 0.74
147 0.72
148 0.7
149 0.63
150 0.56
151 0.53
152 0.53
153 0.51
154 0.48
155 0.48
156 0.44
157 0.5
158 0.47
159 0.43
160 0.4
161 0.41
162 0.45
163 0.44
164 0.42
165 0.34
166 0.35
167 0.38
168 0.36
169 0.34
170 0.31
171 0.31
172 0.32
173 0.32
174 0.31
175 0.28
176 0.23
177 0.18
178 0.14
179 0.13
180 0.11
181 0.09
182 0.08
183 0.08
184 0.08
185 0.08
186 0.12
187 0.14
188 0.17
189 0.22
190 0.25
191 0.25
192 0.27
193 0.3
194 0.3