Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SBY5

Protein Details
Accession A0A4Y7SBY5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-39APQPCYEIRRPMRTRRRKIGRLQFLITHydrophilic
NLS Segment(s)
PositionSequence
25-30RTRRRK
Subcellular Location(s) nucl 11, mito 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MGACLPTCLPCSAPQPCYEIRRPMRTRRRKIGRLQFLITQVIVTLAPRLVYPFSSTRVMPDAQLASTKLSRRPMWIYKRKSSAEAFIKHRTDSEAATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.37
4 0.42
5 0.44
6 0.47
7 0.48
8 0.57
9 0.61
10 0.67
11 0.73
12 0.77
13 0.81
14 0.82
15 0.86
16 0.83
17 0.87
18 0.87
19 0.86
20 0.81
21 0.74
22 0.66
23 0.57
24 0.5
25 0.4
26 0.28
27 0.18
28 0.13
29 0.1
30 0.07
31 0.05
32 0.04
33 0.05
34 0.05
35 0.06
36 0.05
37 0.06
38 0.09
39 0.09
40 0.12
41 0.14
42 0.14
43 0.15
44 0.17
45 0.17
46 0.14
47 0.15
48 0.13
49 0.12
50 0.13
51 0.13
52 0.13
53 0.16
54 0.18
55 0.2
56 0.25
57 0.26
58 0.29
59 0.36
60 0.43
61 0.5
62 0.58
63 0.62
64 0.64
65 0.72
66 0.69
67 0.67
68 0.61
69 0.59
70 0.58
71 0.57
72 0.55
73 0.56
74 0.56
75 0.51
76 0.49
77 0.44
78 0.38