Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TPK8

Protein Details
Accession A0A4Y7TPK8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKRPTSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKRPTSHRTTSMKGVDPKFRRNARFALVGSNKARAEQKAAAAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.84
8 0.8
9 0.74
10 0.72
11 0.7
12 0.66
13 0.6
14 0.57
15 0.51
16 0.47
17 0.5
18 0.46
19 0.44
20 0.44
21 0.44
22 0.46
23 0.45
24 0.48
25 0.5
26 0.54
27 0.52
28 0.5
29 0.5
30 0.45
31 0.47
32 0.41
33 0.42
34 0.39
35 0.42
36 0.4
37 0.41
38 0.37
39 0.35
40 0.38
41 0.3
42 0.33
43 0.3