Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TML0

Protein Details
Accession A0A4Y7TML0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-61DSYNKGKQWKDIRHKYIQEDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MALSNLIYNGIFKRNSVFVATVFAGAFAFGIGFDTGVTKFYDSYNKGKQWKDIRHKYIQED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.19
5 0.14
6 0.18
7 0.18
8 0.15
9 0.13
10 0.12
11 0.1
12 0.08
13 0.08
14 0.04
15 0.03
16 0.02
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.06
24 0.06
25 0.06
26 0.07
27 0.08
28 0.15
29 0.18
30 0.25
31 0.32
32 0.39
33 0.45
34 0.47
35 0.55
36 0.58
37 0.65
38 0.7
39 0.72
40 0.73
41 0.77