Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SJL8

Protein Details
Accession A0A4Y7SJL8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
3-22VLERARRRYRAGKGRYRGSSBasic
NLS Segment(s)
PositionSequence
8-17RRRYRAGKGR
Subcellular Location(s) mito 11, nucl 5, plas 5, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYVLERARRRYRAGKGRYRGSSDPPRISLSPSPSSGIPHSQFAPYPLSVIPSPRPSGLVPPKANTNVRQWQGSRYSNRGSPSLYSCHPSPFGYLSGFLYHSRFSFDLHLLSVLIYLTFPSLFFRSVTFLPAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.81
4 0.8
5 0.78
6 0.71
7 0.69
8 0.7
9 0.67
10 0.64
11 0.57
12 0.56
13 0.49
14 0.51
15 0.47
16 0.42
17 0.38
18 0.34
19 0.34
20 0.29
21 0.31
22 0.29
23 0.3
24 0.25
25 0.23
26 0.23
27 0.22
28 0.22
29 0.21
30 0.23
31 0.16
32 0.16
33 0.13
34 0.15
35 0.14
36 0.17
37 0.18
38 0.18
39 0.19
40 0.18
41 0.2
42 0.17
43 0.25
44 0.3
45 0.35
46 0.33
47 0.33
48 0.36
49 0.38
50 0.4
51 0.34
52 0.33
53 0.32
54 0.32
55 0.34
56 0.31
57 0.32
58 0.36
59 0.39
60 0.36
61 0.33
62 0.35
63 0.35
64 0.36
65 0.33
66 0.28
67 0.24
68 0.24
69 0.23
70 0.22
71 0.22
72 0.21
73 0.22
74 0.23
75 0.21
76 0.2
77 0.18
78 0.18
79 0.16
80 0.16
81 0.15
82 0.15
83 0.16
84 0.15
85 0.14
86 0.14
87 0.13
88 0.16
89 0.15
90 0.15
91 0.17
92 0.18
93 0.18
94 0.17
95 0.18
96 0.14
97 0.13
98 0.12
99 0.08
100 0.07
101 0.06
102 0.05
103 0.06
104 0.06
105 0.06
106 0.09
107 0.11
108 0.12
109 0.12
110 0.14
111 0.17
112 0.18