Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7S2K9

Protein Details
Accession A0A4Y7S2K9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
118-143EDDAWFKYMKKWNRKQRKGEISNEELHydrophilic
NLS Segment(s)
PositionSequence
131-135RKQRK
148-158RRWQKKHGKKA
Subcellular Location(s) cyto 12, cyto_nucl 10.5, nucl 7, pero 4, mito 2
Family & Domain DBs
Amino Acid Sequences PAFFVDRQYKQAAPKLQHEKERFSVLHEEAFIEGDTFRFTRRYFSDSDAEAIYTFMEKVAGRPASDVEKDLVMKWVVDSSEVIMRNVITREYLNFPAEPGIGIQGDPGEVDDSMAKAEDDAWFKYMKKWNRKQRKGEISNEELGEAFRRWQKKHGKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.61
4 0.67
5 0.66
6 0.65
7 0.61
8 0.63
9 0.53
10 0.47
11 0.47
12 0.39
13 0.37
14 0.31
15 0.28
16 0.21
17 0.22
18 0.17
19 0.11
20 0.1
21 0.07
22 0.09
23 0.09
24 0.09
25 0.11
26 0.12
27 0.17
28 0.2
29 0.23
30 0.24
31 0.28
32 0.31
33 0.29
34 0.31
35 0.25
36 0.22
37 0.19
38 0.16
39 0.12
40 0.08
41 0.07
42 0.05
43 0.06
44 0.06
45 0.06
46 0.12
47 0.13
48 0.13
49 0.13
50 0.15
51 0.17
52 0.17
53 0.17
54 0.12
55 0.12
56 0.13
57 0.13
58 0.13
59 0.1
60 0.09
61 0.08
62 0.09
63 0.07
64 0.07
65 0.07
66 0.06
67 0.1
68 0.11
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.1
75 0.07
76 0.07
77 0.09
78 0.13
79 0.15
80 0.15
81 0.14
82 0.14
83 0.14
84 0.14
85 0.12
86 0.09
87 0.08
88 0.06
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.06
102 0.05
103 0.05
104 0.06
105 0.09
106 0.11
107 0.12
108 0.13
109 0.14
110 0.15
111 0.23
112 0.31
113 0.36
114 0.45
115 0.54
116 0.65
117 0.75
118 0.84
119 0.87
120 0.9
121 0.92
122 0.89
123 0.88
124 0.85
125 0.79
126 0.74
127 0.64
128 0.53
129 0.42
130 0.35
131 0.29
132 0.21
133 0.2
134 0.21
135 0.28
136 0.3
137 0.39
138 0.49