Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DEY2

Protein Details
Accession A5DEY2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
120-143QWEIHTKSRRHKKQVGYELRKIKHBasic
NLS Segment(s)
PositionSequence
127-152SRRHKKQVGYELRKIKHEELKMRYKR
Subcellular Location(s) mito 13.5, mito_nucl 12.166, nucl 9.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
KEGG pgu:PGUG_01833  -  
Amino Acid Sequences MPNIKVKWIRKLLGVELQKEARFGYKYGGKLYMLDATDLQVWDQSVKNRGVSIANQFLESGPISVTDAQIPERLQSQFDLNTGLTRSNKTLGSESNWKHYECSVCKDKSGKPLVSVGKEQWEIHTKSRRHKKQVGYELRKIKHEELKMRYKRPNEESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.44
4 0.46
5 0.41
6 0.37
7 0.33
8 0.28
9 0.25
10 0.23
11 0.24
12 0.26
13 0.27
14 0.3
15 0.32
16 0.28
17 0.27
18 0.28
19 0.26
20 0.21
21 0.19
22 0.16
23 0.15
24 0.16
25 0.15
26 0.13
27 0.09
28 0.09
29 0.1
30 0.12
31 0.14
32 0.17
33 0.19
34 0.19
35 0.19
36 0.2
37 0.2
38 0.2
39 0.22
40 0.24
41 0.22
42 0.22
43 0.22
44 0.21
45 0.2
46 0.18
47 0.13
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.07
54 0.07
55 0.08
56 0.1
57 0.09
58 0.09
59 0.11
60 0.11
61 0.11
62 0.11
63 0.12
64 0.11
65 0.11
66 0.12
67 0.09
68 0.1
69 0.1
70 0.12
71 0.11
72 0.11
73 0.12
74 0.13
75 0.14
76 0.14
77 0.16
78 0.15
79 0.19
80 0.26
81 0.26
82 0.31
83 0.33
84 0.31
85 0.31
86 0.31
87 0.34
88 0.28
89 0.34
90 0.34
91 0.33
92 0.36
93 0.39
94 0.41
95 0.43
96 0.48
97 0.42
98 0.36
99 0.42
100 0.44
101 0.43
102 0.42
103 0.34
104 0.32
105 0.34
106 0.32
107 0.29
108 0.32
109 0.32
110 0.37
111 0.45
112 0.43
113 0.52
114 0.63
115 0.69
116 0.71
117 0.76
118 0.78
119 0.8
120 0.86
121 0.87
122 0.85
123 0.84
124 0.84
125 0.79
126 0.74
127 0.69
128 0.65
129 0.61
130 0.61
131 0.61
132 0.6
133 0.68
134 0.72
135 0.75
136 0.76
137 0.76
138 0.77