Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TRH1

Protein Details
Accession A0A4Y7TRH1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
120-145SPTGHSVPAAPRKKRRQPEAIWDPALHydrophilic
NLS Segment(s)
PositionSequence
131-134RKKR
Subcellular Location(s) nucl 10, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MKSSAYHYRSGVLTGALIEEKIFGTDRTTYSLASKPVSRRRILSPEDLARIRPRILSFIRDLMVSVSIAERWHHLHSSKPFRSLSAGLNTSIHPCSHLPAEGARQELEGPAGDLATELRSPTGHSVPAAPRKKRRQPEAIWDPALIWVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.1
4 0.09
5 0.08
6 0.07
7 0.07
8 0.08
9 0.09
10 0.08
11 0.1
12 0.13
13 0.14
14 0.18
15 0.19
16 0.19
17 0.21
18 0.24
19 0.24
20 0.24
21 0.28
22 0.31
23 0.4
24 0.45
25 0.44
26 0.44
27 0.48
28 0.54
29 0.52
30 0.5
31 0.47
32 0.45
33 0.48
34 0.45
35 0.41
36 0.36
37 0.34
38 0.29
39 0.25
40 0.21
41 0.22
42 0.23
43 0.24
44 0.23
45 0.23
46 0.22
47 0.19
48 0.19
49 0.14
50 0.13
51 0.09
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.09
59 0.1
60 0.12
61 0.12
62 0.17
63 0.25
64 0.35
65 0.35
66 0.37
67 0.36
68 0.35
69 0.38
70 0.34
71 0.3
72 0.25
73 0.24
74 0.21
75 0.21
76 0.21
77 0.2
78 0.19
79 0.15
80 0.12
81 0.11
82 0.12
83 0.12
84 0.13
85 0.11
86 0.12
87 0.17
88 0.17
89 0.18
90 0.16
91 0.15
92 0.15
93 0.14
94 0.13
95 0.09
96 0.08
97 0.06
98 0.06
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.07
106 0.07
107 0.09
108 0.13
109 0.15
110 0.15
111 0.15
112 0.2
113 0.27
114 0.38
115 0.45
116 0.49
117 0.57
118 0.67
119 0.77
120 0.81
121 0.83
122 0.83
123 0.82
124 0.85
125 0.85
126 0.82
127 0.74
128 0.64
129 0.55