Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7U1E6

Protein Details
Accession A0A4Y7U1E6    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTIDRLQWARRRTKRIKFYTKIRRVCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MTIDRLQWARRRTKRIKFYTKIRRVCPAVTLGTSYQKLQQSRLQKLGLPRKDHYTTREVCKRLCASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.88
4 0.85
5 0.87
6 0.88
7 0.88
8 0.85
9 0.77
10 0.74
11 0.66
12 0.59
13 0.51
14 0.43
15 0.34
16 0.27
17 0.26
18 0.19
19 0.19
20 0.19
21 0.17
22 0.18
23 0.21
24 0.21
25 0.22
26 0.27
27 0.32
28 0.37
29 0.41
30 0.37
31 0.36
32 0.44
33 0.51
34 0.53
35 0.5
36 0.47
37 0.5
38 0.55
39 0.56
40 0.52
41 0.5
42 0.49
43 0.53
44 0.6
45 0.55
46 0.51
47 0.56