Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SA67

Protein Details
Accession A0A4Y7SA67   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22VLERARRRYRAGKGRYRGSSBasic
NLS Segment(s)
PositionSequence
8-17RRRYRAGKGR
Subcellular Location(s) mito 11, nucl 5, plas 3, cyto_nucl 3, extr 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYVLERARRRYRAGKGRYRGSSDPPRIPLSTSPSPSSGIPHSQFAPYPVSVIPSPRHSGLVSPKANKNVRQWQASRYSNRGSPSLYSCHPSPFGYLSGFLYHSRLSFDLHLLSVLIYLTFPSLFFRSVTFLPAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.81
4 0.8
5 0.78
6 0.71
7 0.69
8 0.7
9 0.67
10 0.64
11 0.59
12 0.57
13 0.51
14 0.5
15 0.45
16 0.42
17 0.41
18 0.39
19 0.37
20 0.34
21 0.35
22 0.33
23 0.32
24 0.27
25 0.26
26 0.24
27 0.24
28 0.24
29 0.23
30 0.23
31 0.22
32 0.22
33 0.16
34 0.15
35 0.13
36 0.15
37 0.14
38 0.17
39 0.17
40 0.17
41 0.19
42 0.18
43 0.2
44 0.17
45 0.2
46 0.24
47 0.31
48 0.31
49 0.32
50 0.34
51 0.41
52 0.43
53 0.44
54 0.45
55 0.45
56 0.46
57 0.48
58 0.47
59 0.44
60 0.5
61 0.52
62 0.48
63 0.43
64 0.41
65 0.38
66 0.39
67 0.36
68 0.28
69 0.25
70 0.24
71 0.24
72 0.22
73 0.22
74 0.21
75 0.22
76 0.23
77 0.21
78 0.2
79 0.18
80 0.18
81 0.16
82 0.16
83 0.15
84 0.15
85 0.16
86 0.14
87 0.14
88 0.13
89 0.13
90 0.14
91 0.13
92 0.14
93 0.14
94 0.15
95 0.15
96 0.14
97 0.14
98 0.12
99 0.11
100 0.09
101 0.08
102 0.06
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.09
109 0.11
110 0.12
111 0.13
112 0.14
113 0.17
114 0.18