Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DKN2

Protein Details
Accession A5DKN2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-32LLKEKILRKYEEKKRQRKSLDVGBasic
NLS Segment(s)
PositionSequence
22-24KKR
Subcellular Location(s) mito 12.5, cyto_mito 8.833, nucl 6.5, cyto_nucl 5.833, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pgu:PGUG_03833  -  
Amino Acid Sequences MATSSRRSLLLKEKILRKYEEKKRQRKSLDVGLQEECPDEVIRTNKRWSYFWFCFALFVICKKVVDTVRASREPLKIILRFICVVTCVVTCCITFNYFCPSRKITISGIIDLPLHPQYLTDGEVFQVISMLILLTCPSRKSTEKNEIKNEKDEIKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.66
4 0.64
5 0.66
6 0.68
7 0.71
8 0.74
9 0.78
10 0.83
11 0.87
12 0.86
13 0.83
14 0.8
15 0.79
16 0.77
17 0.71
18 0.64
19 0.56
20 0.5
21 0.42
22 0.35
23 0.24
24 0.17
25 0.13
26 0.1
27 0.12
28 0.18
29 0.22
30 0.25
31 0.31
32 0.33
33 0.35
34 0.37
35 0.39
36 0.42
37 0.4
38 0.4
39 0.37
40 0.34
41 0.32
42 0.3
43 0.27
44 0.18
45 0.16
46 0.16
47 0.14
48 0.14
49 0.13
50 0.18
51 0.16
52 0.18
53 0.21
54 0.24
55 0.29
56 0.3
57 0.31
58 0.31
59 0.31
60 0.29
61 0.28
62 0.27
63 0.22
64 0.22
65 0.22
66 0.19
67 0.18
68 0.17
69 0.14
70 0.1
71 0.09
72 0.09
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.1
83 0.16
84 0.2
85 0.21
86 0.24
87 0.26
88 0.27
89 0.28
90 0.3
91 0.25
92 0.28
93 0.29
94 0.27
95 0.25
96 0.23
97 0.22
98 0.19
99 0.2
100 0.13
101 0.11
102 0.09
103 0.09
104 0.1
105 0.11
106 0.13
107 0.1
108 0.1
109 0.1
110 0.11
111 0.1
112 0.08
113 0.07
114 0.05
115 0.05
116 0.04
117 0.04
118 0.03
119 0.04
120 0.04
121 0.06
122 0.08
123 0.09
124 0.12
125 0.17
126 0.22
127 0.29
128 0.38
129 0.47
130 0.55
131 0.63
132 0.72
133 0.76
134 0.76
135 0.75
136 0.71
137 0.68