FuNGI

A0A4Y7SRA8

Protein Details

Accession

A0A4Y7SRA8

Localization Confidence

Low

Confidence Score

6.7

NoLS Segment(s)

Position	Sequence	Protein Nature
332-352	LPPPSRPRPIPRLNTNRPFVS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 20, nucl 5, cyto_nucl 4.5

Family & Domain DBs

Amino Acid Sequences

MSFIPKYLLRSPAPTAQNAIGNQWLAPNQSTALNRVEDDDDDDADAMSENHDSDIDMLFDGLPTMSASSEDEMAAEIEASLQVRSGENSDCLPGPVAPAELPLPGPVPTLPGRVPPAPDARSLPGPVPSAPLAAPPLPGRVPHAPTANPRLPGRVPSAPEAPLPPSIPPATQAKPALPGRVPPANQAKPGMPGRVPPAPRAESVLPGPVPSAPKAALPLPGRVPPAADARPLPGPVPSAPQAAPPLPGRVPPAPTPKPALPGRVPSAPNAPLSRPTPPALKAKPALPGHVPSAPPATPPLPGHIPSAPQAQPALPGPVPSAATLPLPPTSALPPPSRPRPIPRLNTNRPFVSDITSRKTKRAQPSSAPIPIPTPNDVVMIDSDSSDMGGQGGVSPDVIWVSDDEDCYELRSLLRQGVE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.42
3	0.39
4	0.42
5	0.37
6	0.35
7	0.29
8	0.26
9	0.25
10	0.23
11	0.22
12	0.19
13	0.19
14	0.18
15	0.16
16	0.21
17	0.22
18	0.23
19	0.25
20	0.24
21	0.23
22	0.25
23	0.25
24	0.21
25	0.23
26	0.22
27	0.19
28	0.18
29	0.17
30	0.14
31	0.12
32	0.12
33	0.08
34	0.07
35	0.07
36	0.07
37	0.07
38	0.07
39	0.07
40	0.08
41	0.09
42	0.09
43	0.08
44	0.08
45	0.08
46	0.07
47	0.08
48	0.06
49	0.05
50	0.05
51	0.05
52	0.05
53	0.06
54	0.07
55	0.08
56	0.09
57	0.09
58	0.08
59	0.09
60	0.09
61	0.08
62	0.07
63	0.05
64	0.05
65	0.06
66	0.06
67	0.05
68	0.06
69	0.06
70	0.07
71	0.08
72	0.1
73	0.11
74	0.12
75	0.13
76	0.15
77	0.14
78	0.14
79	0.14
80	0.12
81	0.12
82	0.11
83	0.11
84	0.09
85	0.1
86	0.1
87	0.09
88	0.1
89	0.09
90	0.09
91	0.09
92	0.1
93	0.08
94	0.12
95	0.12
96	0.15
97	0.15
98	0.18
99	0.22
100	0.23
101	0.25
102	0.25
103	0.31
104	0.29
105	0.31
106	0.3
107	0.29
108	0.3
109	0.29
110	0.26
111	0.23
112	0.23
113	0.21
114	0.21
115	0.18
116	0.17
117	0.15
118	0.15
119	0.14
120	0.13
121	0.14
122	0.12
123	0.14
124	0.13
125	0.14
126	0.18
127	0.2
128	0.23
129	0.25
130	0.27
131	0.27
132	0.31
133	0.39
134	0.38
135	0.37
136	0.34
137	0.34
138	0.32
139	0.33
140	0.34
141	0.3
142	0.28
143	0.28
144	0.3
145	0.27
146	0.27
147	0.25
148	0.21
149	0.19
150	0.18
151	0.15
152	0.15
153	0.15
154	0.14
155	0.15
156	0.18
157	0.18
158	0.21
159	0.22
160	0.19
161	0.25
162	0.27
163	0.28
164	0.23
165	0.23
166	0.23
167	0.28
168	0.27
169	0.26
170	0.34
171	0.33
172	0.34
173	0.33
174	0.3
175	0.3
176	0.32
177	0.28
178	0.2
179	0.19
180	0.22
181	0.26
182	0.26
183	0.22
184	0.26
185	0.26
186	0.25
187	0.28
188	0.24
189	0.21
190	0.2
191	0.21
192	0.15
193	0.13
194	0.13
195	0.11
196	0.12
197	0.11
198	0.11
199	0.09
200	0.09
201	0.11
202	0.11
203	0.16
204	0.16
205	0.18
206	0.18
207	0.2
208	0.21
209	0.2
210	0.19
211	0.15
212	0.19
213	0.17
214	0.17
215	0.14
216	0.16
217	0.17
218	0.17
219	0.15
220	0.11
221	0.12
222	0.11
223	0.15
224	0.14
225	0.15
226	0.15
227	0.16
228	0.18
229	0.16
230	0.18
231	0.15
232	0.17
233	0.15
234	0.17
235	0.19
236	0.19
237	0.22
238	0.25
239	0.33
240	0.33
241	0.34
242	0.38
243	0.35
244	0.4
245	0.38
246	0.38
247	0.32
248	0.34
249	0.36
250	0.37
251	0.36
252	0.31
253	0.34
254	0.31
255	0.31
256	0.28
257	0.25
258	0.24
259	0.25
260	0.27
261	0.25
262	0.25
263	0.26
264	0.28
265	0.36
266	0.33
267	0.37
268	0.36
269	0.35
270	0.42
271	0.39
272	0.38
273	0.32
274	0.32
275	0.29
276	0.31
277	0.29
278	0.22
279	0.25
280	0.22
281	0.19
282	0.2
283	0.18
284	0.18
285	0.18
286	0.21
287	0.21
288	0.22
289	0.25
290	0.23
291	0.24
292	0.23
293	0.28
294	0.24
295	0.22
296	0.21
297	0.19
298	0.19
299	0.19
300	0.22
301	0.15
302	0.16
303	0.15
304	0.17
305	0.17
306	0.15
307	0.15
308	0.11
309	0.12
310	0.12
311	0.13
312	0.12
313	0.12
314	0.12
315	0.13
316	0.15
317	0.18
318	0.22
319	0.24
320	0.3
321	0.37
322	0.45
323	0.5
324	0.53
325	0.57
326	0.63
327	0.69
328	0.71
329	0.74
330	0.76
331	0.8
332	0.83
333	0.8
334	0.73
335	0.66
336	0.6
337	0.5
338	0.45
339	0.42
340	0.38
341	0.41
342	0.48
343	0.46
344	0.48
345	0.55
346	0.57
347	0.62
348	0.66
349	0.67
350	0.66
351	0.74
352	0.76
353	0.75
354	0.67
355	0.57
356	0.51
357	0.48
358	0.43
359	0.36
360	0.3
361	0.25
362	0.25
363	0.24
364	0.22
365	0.18
366	0.17
367	0.15
368	0.12
369	0.12
370	0.1
371	0.1
372	0.09
373	0.08
374	0.06
375	0.05
376	0.05
377	0.06
378	0.08
379	0.07
380	0.07
381	0.07
382	0.08
383	0.08
384	0.08
385	0.07
386	0.07
387	0.09
388	0.11
389	0.12
390	0.13
391	0.14
392	0.14
393	0.16
394	0.17
395	0.15
396	0.14
397	0.18
398	0.19

A0A4Y7SRA8

3D AlphaFold-predicted Structure Viewer