Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DB06

Protein Details
Accession A5DB06    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
317-341EQLKLEKKAAEKRQRKAAKKQKVRMBasic
NLS Segment(s)
PositionSequence
297-341EEKAKLKREERLRNRELSDAEQLKLEKKAAEKRQRKAAKKQKVRM
Subcellular Location(s) nucl 7, E.R. 6, golg 3, mito 2, cyto 2, plas 2, pero 2, vacu 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012879  CCDC47  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0032469  P:endoplasmic reticulum calcium ion homeostasis  
KEGG pgu:PGUG_00461  -  
Pfam View protein in Pfam  
PF07946  CCDC47  
Amino Acid Sequences MGLVNRIKLTNWRLEVITLSTILVFCFLFKIGDLYNQRKVKAYLNGLSDLFTNNFYQFGVAPDKLYVKDSAESYSSYATGRVNIAKVNLEFRLKPRHNLFVLVLETIMSFFTSNVQAPSDRVDIIITPSSDAEYDNFISAIVSKIGMNEFRKFNYFLSLTKTSDSDSLPQSFVFMSESSEIQDKLLSPEIKDALTMESASWLKYVAFTDQSVERPSTLSEYSPRRRIIIATDVASSSVQIKQISDVLSGVFNLVDKLAAKEITFKSETLRKVVKTRENELAKWKRIEDEIKQEKLAEEKAKLKREERLRNRELSDAEQLKLEKKAAEKRQRKAAKKQKVRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.32
4 0.28
5 0.2
6 0.17
7 0.15
8 0.14
9 0.13
10 0.12
11 0.09
12 0.07
13 0.08
14 0.08
15 0.08
16 0.08
17 0.11
18 0.1
19 0.19
20 0.26
21 0.3
22 0.39
23 0.42
24 0.43
25 0.45
26 0.47
27 0.45
28 0.46
29 0.48
30 0.44
31 0.44
32 0.46
33 0.42
34 0.4
35 0.34
36 0.28
37 0.21
38 0.18
39 0.16
40 0.13
41 0.13
42 0.12
43 0.13
44 0.11
45 0.13
46 0.17
47 0.16
48 0.16
49 0.18
50 0.2
51 0.2
52 0.21
53 0.19
54 0.16
55 0.19
56 0.19
57 0.19
58 0.18
59 0.18
60 0.18
61 0.17
62 0.15
63 0.13
64 0.14
65 0.12
66 0.12
67 0.14
68 0.15
69 0.15
70 0.15
71 0.16
72 0.18
73 0.19
74 0.2
75 0.2
76 0.21
77 0.22
78 0.25
79 0.34
80 0.33
81 0.39
82 0.4
83 0.45
84 0.43
85 0.44
86 0.41
87 0.36
88 0.35
89 0.27
90 0.23
91 0.15
92 0.14
93 0.12
94 0.1
95 0.05
96 0.04
97 0.04
98 0.06
99 0.08
100 0.09
101 0.09
102 0.1
103 0.1
104 0.11
105 0.14
106 0.14
107 0.12
108 0.12
109 0.11
110 0.1
111 0.13
112 0.14
113 0.11
114 0.1
115 0.1
116 0.1
117 0.1
118 0.1
119 0.08
120 0.08
121 0.09
122 0.09
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.05
129 0.05
130 0.05
131 0.06
132 0.07
133 0.11
134 0.13
135 0.16
136 0.17
137 0.18
138 0.2
139 0.21
140 0.2
141 0.21
142 0.2
143 0.17
144 0.23
145 0.25
146 0.23
147 0.22
148 0.22
149 0.18
150 0.19
151 0.19
152 0.15
153 0.14
154 0.15
155 0.15
156 0.14
157 0.14
158 0.12
159 0.11
160 0.1
161 0.07
162 0.07
163 0.07
164 0.08
165 0.08
166 0.09
167 0.09
168 0.08
169 0.08
170 0.07
171 0.09
172 0.14
173 0.14
174 0.13
175 0.15
176 0.16
177 0.16
178 0.15
179 0.14
180 0.09
181 0.09
182 0.09
183 0.06
184 0.09
185 0.09
186 0.09
187 0.09
188 0.08
189 0.07
190 0.08
191 0.09
192 0.08
193 0.09
194 0.09
195 0.11
196 0.13
197 0.15
198 0.15
199 0.15
200 0.14
201 0.13
202 0.13
203 0.14
204 0.13
205 0.13
206 0.17
207 0.26
208 0.31
209 0.37
210 0.38
211 0.36
212 0.36
213 0.36
214 0.34
215 0.32
216 0.29
217 0.24
218 0.24
219 0.23
220 0.23
221 0.21
222 0.17
223 0.12
224 0.1
225 0.11
226 0.11
227 0.11
228 0.12
229 0.14
230 0.15
231 0.14
232 0.13
233 0.11
234 0.11
235 0.1
236 0.09
237 0.07
238 0.06
239 0.05
240 0.05
241 0.05
242 0.06
243 0.07
244 0.09
245 0.1
246 0.1
247 0.17
248 0.18
249 0.22
250 0.23
251 0.22
252 0.25
253 0.31
254 0.32
255 0.32
256 0.36
257 0.34
258 0.4
259 0.48
260 0.52
261 0.52
262 0.55
263 0.58
264 0.58
265 0.57
266 0.61
267 0.62
268 0.59
269 0.57
270 0.53
271 0.46
272 0.47
273 0.5
274 0.46
275 0.48
276 0.51
277 0.51
278 0.5
279 0.48
280 0.43
281 0.41
282 0.41
283 0.35
284 0.31
285 0.37
286 0.45
287 0.52
288 0.56
289 0.55
290 0.58
291 0.63
292 0.7
293 0.71
294 0.74
295 0.72
296 0.74
297 0.74
298 0.71
299 0.63
300 0.57
301 0.56
302 0.48
303 0.43
304 0.39
305 0.38
306 0.35
307 0.35
308 0.32
309 0.25
310 0.3
311 0.39
312 0.47
313 0.56
314 0.62
315 0.67
316 0.76
317 0.83
318 0.84
319 0.85
320 0.85
321 0.86