Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7RB74

Protein Details
Accession A0A4Y7RB74   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
26-48EGLIQAKKRRKLRTPPNRVAARNHydrophilic
NLS Segment(s)
PositionSequence
32-42KKRRKLRTPPN
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
Amino Acid Sequences MTLGQRPLNPRQCLRLHLGFTSRLFEGLIQAKKRRKLRTPPNRVAARNRTTAFSPGQIDCRMEVGLYMLSRSMVMIMMGGASVHEIWAASGAITVVVGWEGRCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.46
4 0.43
5 0.43
6 0.4
7 0.37
8 0.36
9 0.28
10 0.22
11 0.19
12 0.16
13 0.17
14 0.2
15 0.25
16 0.27
17 0.34
18 0.4
19 0.47
20 0.55
21 0.59
22 0.61
23 0.66
24 0.73
25 0.77
26 0.81
27 0.82
28 0.84
29 0.82
30 0.76
31 0.74
32 0.71
33 0.64
34 0.59
35 0.51
36 0.43
37 0.38
38 0.37
39 0.3
40 0.23
41 0.21
42 0.16
43 0.19
44 0.18
45 0.17
46 0.15
47 0.15
48 0.13
49 0.1
50 0.09
51 0.07
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.03
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.05