Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T740

Protein Details
Accession A0A4Y7T740   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKKRRSGGRNKKGRGHVGFBasic
86-114VRSREGRRVRTPPPRVRWKDGKKVNPAVAHydrophilic
NLS Segment(s)
PositionSequence
3-16KKRRSGGRNKKGRG
87-108RSREGRRVRTPPPRVRWKDGKK
Subcellular Location(s) mito 16, cyto 8, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRSGGRNKKGRGHVGFVRCSNCSRCVPKDKAIKRFTVRNMVESAAVRDISEASVYADYVIPKLYIKIAYCVSCAIHSHVVRVRSREGRRVRTPPPRVRWKDGKKVNPAVAAAEDAKAKAAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.77
3 0.73
4 0.7
5 0.67
6 0.65
7 0.6
8 0.55
9 0.47
10 0.46
11 0.42
12 0.39
13 0.39
14 0.39
15 0.43
16 0.49
17 0.53
18 0.57
19 0.64
20 0.67
21 0.7
22 0.67
23 0.68
24 0.63
25 0.65
26 0.61
27 0.61
28 0.54
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.12
38 0.1
39 0.1
40 0.08
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.08
57 0.11
58 0.13
59 0.13
60 0.14
61 0.14
62 0.13
63 0.12
64 0.13
65 0.13
66 0.18
67 0.17
68 0.21
69 0.23
70 0.28
71 0.29
72 0.31
73 0.34
74 0.36
75 0.4
76 0.45
77 0.51
78 0.55
79 0.61
80 0.65
81 0.68
82 0.7
83 0.77
84 0.77
85 0.79
86 0.81
87 0.8
88 0.82
89 0.84
90 0.83
91 0.83
92 0.83
93 0.83
94 0.81
95 0.82
96 0.78
97 0.71
98 0.62
99 0.53
100 0.44
101 0.38
102 0.29
103 0.23
104 0.19
105 0.15