Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SX85

Protein Details
Accession A0A4Y7SX85    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-29FTPASCNRKSRKSKAGDRLKVNYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046357  PPIase_dom_sf  
IPR001179  PPIase_FKBP_dom  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
Pfam View protein in Pfam  
PF00254  FKBP_C  
PROSITE View protein in PROSITE  
PS50059  FKBP_PPIASE  
Amino Acid Sequences LKVETTFTPASCNRKSRKSKAGDRLKVNYVGFLFSLLPRYLSSTPTSSPASPTSSTSGFGQVIAGWDRGLTKMCVGEKRVLTIPASQTNREYILSFIQIRFVSPKSCSFCRILSCVLFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.66
3 0.69
4 0.74
5 0.76
6 0.79
7 0.82
8 0.86
9 0.84
10 0.82
11 0.79
12 0.73
13 0.69
14 0.58
15 0.5
16 0.4
17 0.32
18 0.24
19 0.2
20 0.16
21 0.11
22 0.14
23 0.11
24 0.12
25 0.11
26 0.16
27 0.15
28 0.16
29 0.18
30 0.17
31 0.18
32 0.2
33 0.23
34 0.18
35 0.2
36 0.2
37 0.21
38 0.19
39 0.2
40 0.19
41 0.18
42 0.19
43 0.17
44 0.17
45 0.13
46 0.12
47 0.11
48 0.08
49 0.09
50 0.09
51 0.08
52 0.06
53 0.06
54 0.06
55 0.07
56 0.08
57 0.07
58 0.07
59 0.1
60 0.12
61 0.15
62 0.17
63 0.22
64 0.21
65 0.24
66 0.26
67 0.24
68 0.23
69 0.23
70 0.25
71 0.28
72 0.31
73 0.29
74 0.28
75 0.29
76 0.29
77 0.27
78 0.23
79 0.16
80 0.16
81 0.19
82 0.19
83 0.18
84 0.2
85 0.19
86 0.2
87 0.22
88 0.21
89 0.21
90 0.22
91 0.29
92 0.32
93 0.34
94 0.37
95 0.37
96 0.39
97 0.41
98 0.42
99 0.4