Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7SDI7

Protein Details
Accession A0A4Y7SDI7    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-44QTRAERPPVDKPPRRSKRQRGATVAPHydrophilic
NLS Segment(s)
PositionSequence
28-38DKPPRRSKRQR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MTKATEVGEATTPRAKCSQTRAERPPVDKPPRRSKRQRGATVAPGPLALPVQEGDASATLPTLSLPNPPIIPAPAPLANSAQKPEQPTPDDIFSSKEDNSNGFGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.35
5 0.42
6 0.46
7 0.55
8 0.6
9 0.66
10 0.7
11 0.7
12 0.71
13 0.7
14 0.72
15 0.7
16 0.72
17 0.73
18 0.77
19 0.82
20 0.84
21 0.84
22 0.85
23 0.87
24 0.87
25 0.83
26 0.79
27 0.77
28 0.71
29 0.61
30 0.5
31 0.39
32 0.31
33 0.23
34 0.18
35 0.09
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.07
52 0.08
53 0.09
54 0.1
55 0.1
56 0.11
57 0.11
58 0.12
59 0.11
60 0.14
61 0.14
62 0.15
63 0.15
64 0.18
65 0.19
66 0.2
67 0.21
68 0.21
69 0.21
70 0.26
71 0.29
72 0.32
73 0.33
74 0.37
75 0.39
76 0.39
77 0.39
78 0.33
79 0.33
80 0.29
81 0.29
82 0.26
83 0.25
84 0.24
85 0.24