Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TIY4

Protein Details
Accession A0A4Y7TIY4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-37LPSRHFKWCRYGKKDSRPPRRLTTQQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.333, nucl 8, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MTRSRRLVTSGLPSRHFKWCRYGKKDSRPPRRLTTQQASRRLCWSGDLLRRRRSFSIDVYGFPVGPCSAMWNRRDPVWKTARDAMWSSFNVQGIWKSTGGAAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.56
4 0.48
5 0.49
6 0.54
7 0.61
8 0.64
9 0.71
10 0.71
11 0.78
12 0.87
13 0.87
14 0.88
15 0.86
16 0.84
17 0.81
18 0.8
19 0.76
20 0.74
21 0.73
22 0.72
23 0.72
24 0.76
25 0.71
26 0.64
27 0.6
28 0.52
29 0.42
30 0.33
31 0.28
32 0.26
33 0.3
34 0.36
35 0.39
36 0.46
37 0.47
38 0.49
39 0.47
40 0.44
41 0.4
42 0.34
43 0.37
44 0.3
45 0.29
46 0.29
47 0.28
48 0.23
49 0.2
50 0.18
51 0.09
52 0.08
53 0.08
54 0.1
55 0.14
56 0.19
57 0.22
58 0.27
59 0.28
60 0.32
61 0.4
62 0.38
63 0.43
64 0.46
65 0.47
66 0.46
67 0.52
68 0.5
69 0.46
70 0.46
71 0.39
72 0.37
73 0.35
74 0.33
75 0.28
76 0.27
77 0.24
78 0.22
79 0.22
80 0.21
81 0.23
82 0.2
83 0.18
84 0.17