Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TP68

Protein Details
Accession A0A4Y7TP68   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-27KQAPPGHPAKKLTRRSKPRFPALELTHydrophilic
NLS Segment(s)
PositionSequence
10-18AKKLTRRSK
Subcellular Location(s) mito 20.5, cyto_mito 11.833, nucl 4.5, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MKQAPPGHPAKKLTRRSKPRFPALELTVGSTYTISGRLAHGRSGNIETSATRCAEPSCQRHVGESDVQKCWKFRPSTPVLRKEPPDCILHTPMSPPRWGKNLAVYWAGSIRKIRRSEGRGGASCSSFKIRCPMRSGTPRCSHEGRSTLTAGCRRCFADIDVRYLFYKCSRNGNDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.85
4 0.9
5 0.89
6 0.89
7 0.85
8 0.8
9 0.77
10 0.7
11 0.67
12 0.56
13 0.51
14 0.4
15 0.34
16 0.28
17 0.2
18 0.16
19 0.1
20 0.11
21 0.08
22 0.08
23 0.1
24 0.15
25 0.16
26 0.19
27 0.2
28 0.2
29 0.22
30 0.24
31 0.23
32 0.18
33 0.18
34 0.15
35 0.15
36 0.17
37 0.15
38 0.13
39 0.12
40 0.13
41 0.19
42 0.26
43 0.28
44 0.33
45 0.36
46 0.36
47 0.38
48 0.38
49 0.35
50 0.34
51 0.35
52 0.32
53 0.31
54 0.32
55 0.32
56 0.31
57 0.3
58 0.31
59 0.28
60 0.27
61 0.33
62 0.38
63 0.48
64 0.55
65 0.61
66 0.59
67 0.6
68 0.61
69 0.54
70 0.51
71 0.42
72 0.36
73 0.29
74 0.28
75 0.26
76 0.24
77 0.22
78 0.21
79 0.22
80 0.22
81 0.22
82 0.21
83 0.2
84 0.23
85 0.25
86 0.23
87 0.26
88 0.27
89 0.26
90 0.26
91 0.24
92 0.21
93 0.22
94 0.21
95 0.15
96 0.18
97 0.19
98 0.25
99 0.27
100 0.3
101 0.35
102 0.39
103 0.46
104 0.49
105 0.53
106 0.48
107 0.5
108 0.48
109 0.41
110 0.36
111 0.31
112 0.28
113 0.22
114 0.2
115 0.25
116 0.29
117 0.32
118 0.37
119 0.4
120 0.44
121 0.54
122 0.59
123 0.6
124 0.63
125 0.62
126 0.63
127 0.62
128 0.57
129 0.53
130 0.52
131 0.47
132 0.42
133 0.41
134 0.37
135 0.39
136 0.41
137 0.37
138 0.34
139 0.33
140 0.3
141 0.3
142 0.3
143 0.27
144 0.32
145 0.31
146 0.36
147 0.35
148 0.36
149 0.35
150 0.33
151 0.32
152 0.28
153 0.33
154 0.29
155 0.38