Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SRW5

Protein Details
Accession A0A4Y7SRW5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGLATVKRWRWSRRPARRGDVNTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MGLATVKRWRWSRRPARRGDVNTILVTVFALRKSSTEPVASQKTIRWPRSGTGILVMLKARLEVADDVGASKGAEDRRECTAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.84
4 0.86
5 0.83
6 0.79
7 0.75
8 0.67
9 0.57
10 0.48
11 0.39
12 0.29
13 0.23
14 0.16
15 0.1
16 0.07
17 0.07
18 0.07
19 0.08
20 0.11
21 0.13
22 0.14
23 0.14
24 0.15
25 0.2
26 0.24
27 0.24
28 0.22
29 0.21
30 0.29
31 0.36
32 0.36
33 0.33
34 0.31
35 0.32
36 0.37
37 0.37
38 0.28
39 0.22
40 0.23
41 0.2
42 0.2
43 0.19
44 0.13
45 0.12
46 0.11
47 0.09
48 0.06
49 0.08
50 0.07
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.1
57 0.08
58 0.08
59 0.11
60 0.13
61 0.18
62 0.2
63 0.22