Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TRY2

Protein Details
Accession A0A4Y7TRY2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-89KELDNHPQKRRIRKLTPKRPWPIVPBasic
NLS Segment(s)
PositionSequence
72-83QKRRIRKLTPKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MATKRKNESSTVEGRGKKLRLSDEESAPNAGPSSKPISPTQDAEHAPIRVPKSQNNPRGVVTRGKELDNHPQKRRIRKLTPKRPWPIVPTSVSATGPRSAHKEGKNLVCISRKTGLSAYMRRCKDVIIKDGYKTLHLSAMGAAIPLLLQLTCALPPILPFAKDEIKTEITTGTCGVEDEVLPDDDYEDISVRERSKSTLLVVLTIGDGAFEGDTSGPLKRIGKFLSSAARGASGAKSKGKPAQTAVEVVYAEPDQEDLMDML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.54
4 0.49
5 0.47
6 0.47
7 0.46
8 0.5
9 0.52
10 0.5
11 0.54
12 0.52
13 0.48
14 0.41
15 0.35
16 0.28
17 0.23
18 0.17
19 0.15
20 0.2
21 0.19
22 0.23
23 0.26
24 0.32
25 0.35
26 0.38
27 0.38
28 0.38
29 0.38
30 0.38
31 0.39
32 0.33
33 0.31
34 0.33
35 0.32
36 0.31
37 0.33
38 0.36
39 0.42
40 0.51
41 0.57
42 0.58
43 0.57
44 0.54
45 0.55
46 0.51
47 0.48
48 0.41
49 0.41
50 0.37
51 0.36
52 0.36
53 0.36
54 0.44
55 0.47
56 0.53
57 0.5
58 0.56
59 0.62
60 0.69
61 0.76
62 0.75
63 0.75
64 0.78
65 0.84
66 0.87
67 0.91
68 0.9
69 0.87
70 0.83
71 0.77
72 0.72
73 0.67
74 0.61
75 0.53
76 0.45
77 0.41
78 0.36
79 0.32
80 0.27
81 0.23
82 0.21
83 0.19
84 0.18
85 0.2
86 0.22
87 0.28
88 0.3
89 0.34
90 0.35
91 0.39
92 0.42
93 0.39
94 0.38
95 0.37
96 0.34
97 0.33
98 0.32
99 0.28
100 0.25
101 0.25
102 0.26
103 0.26
104 0.32
105 0.35
106 0.39
107 0.39
108 0.39
109 0.38
110 0.34
111 0.35
112 0.33
113 0.31
114 0.3
115 0.31
116 0.31
117 0.34
118 0.33
119 0.27
120 0.24
121 0.18
122 0.13
123 0.12
124 0.11
125 0.08
126 0.09
127 0.07
128 0.06
129 0.06
130 0.04
131 0.04
132 0.03
133 0.03
134 0.02
135 0.02
136 0.03
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.05
143 0.09
144 0.1
145 0.1
146 0.11
147 0.13
148 0.18
149 0.19
150 0.21
151 0.21
152 0.22
153 0.22
154 0.22
155 0.21
156 0.16
157 0.16
158 0.14
159 0.1
160 0.08
161 0.08
162 0.08
163 0.07
164 0.06
165 0.07
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.07
172 0.08
173 0.07
174 0.06
175 0.06
176 0.08
177 0.11
178 0.12
179 0.14
180 0.15
181 0.16
182 0.18
183 0.2
184 0.2
185 0.21
186 0.2
187 0.19
188 0.18
189 0.16
190 0.14
191 0.12
192 0.1
193 0.05
194 0.05
195 0.04
196 0.04
197 0.03
198 0.04
199 0.04
200 0.05
201 0.07
202 0.07
203 0.08
204 0.12
205 0.15
206 0.17
207 0.22
208 0.23
209 0.25
210 0.26
211 0.3
212 0.35
213 0.33
214 0.32
215 0.27
216 0.26
217 0.24
218 0.23
219 0.23
220 0.21
221 0.23
222 0.29
223 0.3
224 0.34
225 0.41
226 0.44
227 0.44
228 0.43
229 0.47
230 0.42
231 0.43
232 0.39
233 0.36
234 0.31
235 0.27
236 0.25
237 0.18
238 0.15
239 0.12
240 0.11
241 0.08
242 0.08